Recombinant Uncharacterized membrane protein yuzI (yuzI)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference for your use.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize the development of the specified tag.
Synonyms
yuzI; BSU31319; Uncharacterized membrane protein YuzI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-87
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yuzI
Target Protein Sequence
MTIFQRTIVVLIGTQLAASAVILFIFDLNSYNHFSGSFSWLHFLKELAGSFAFYLFSAGL
FFLLIGLCAPSRKKKRISVHEKENSLK
Uniprot No.
Target Background
Database Links
KEGG: bsu:BSU31319
STRING: 224308.Bsubs1_010100017021
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
