Recombinant Uncharacterized PPE family protein PPE13 (ppe13)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Protein Structure:

  • Length: 443 amino acids with MPTR (Major Polymorphic Tandem Repeat) domains at the C-terminus

  • Expression System: Produced in E. coli with >90% purity via SDS-PAGE

Physicochemical Properties:

PropertyDetail
Molecular Weight~49 kDa (calculated)
StorageLyophilized at -80°C in Tris/PBS buffer with 6% trehalose
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol recommended for long-term storage

Biochemical Functions

PPE13 directly activates NLRP3 inflammasome through:

  • Domain Interactions: Binds NLRP3’s LRR and NACHT domains via its MPTR region

  • Immune Activation: Induces caspase-1 cleavage, IL-1β secretion, and gasdermin D (GSDMD)-mediated pyroptosis in macrophages

Key Pathways:

PathwayMechanismExperimental Model
NLRP3 InflammasomePPE13-NLRP3 interaction → IL-1β releaseJ774A.1, THP-1, BMDMs
Mycobacterial SurvivalInhibits apoptosis via ER stress modulationM. smegmatis models

Inflammasome Activation

  • Recombinant PPE13 expressed in Mycobacterium smegmatis (Ms_PPE13) increases IL-1β secretion by 3–5 fold compared to vector controls in macrophages .

  • Dependency: NLRP3 and caspase-1 inhibitors abolish IL-1β release .

Cross-Species Conservation

  • PPE13 orthologs from M. bovis and M. marinum similarly activate NLRP3, confirming functional conservation .

Host Cell Death Modulation

Cell TypeEffectOutcome
THP-1↑ GSDMD cleavage → pyroptosisReduced intracellular bacterial survival
RAW264.7↓ Caspase-3/7/9 → apoptosis inhibitionEnhanced mycobacterial persistence

Applications in Research

  • Drug Target Screening: Used to identify NLRP3 inhibitors .

  • Vaccine Development: PPE13’s immunogenicity is being evaluated in subunit vaccines .

  • Pathogenesis Studies: Clarifies how PPE proteins evade host immunity .

Limitations and Challenges

  • Functional Redundancy: Overlaps with other PPE proteins (e.g., PPE60) in modulating cell death pathways .

  • Structural Complexity: MPTR domain’s repetitive sequences complicate crystallization for structural studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized formulations typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We determine the tag type during production. If you require a specific tag type, please inform us, and we will prioritize development according to your specification.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Target Names
ppe13
Target Protein Sequence
MNFMVLPPEVNSARIYAGAGPAPMLAAAVAWDGLAAELGMAAASFSLLISGLTAGPGSAW QGPAAAAMAAAAAPYLSWLNAATARAEGAAAGAKAAAAVYEAARAATAHPALVAANRNQL LSLVLSNLFGQNLPAIAATEASYEQLWAQDVAAMVGYHGGASTVASQLTPWQQLLSVLPP VVTAAPAGAVGVPAALAIPALGVENIGVGNFLGIGNIGNNNVGSGNTGDYNFGIGNIGNA NLGNGNIGNANLGSGNAGFFNFGNGNDGNTNFGSGNAGFLNIGSGNEGSGNLGFGNAGDD NTGWGNSGDTNTGGFNSGDLNTGIGSPVTQGVANSGFGNTGTGHSGFFNSGNSGSGFQNL GNGSSGFGNASDTSSGFQNAGTALTRASSTWADSPRAWPIRAPSRLQVWRTRATTARECS IRVIISRVSSTGAPPQKKVGNSG
Uniprot No.

Q&A

What is PPE13 and which mycobacterial species express it?

PPE13 is a member of the PPE family of proteins found predominantly in pathogenic mycobacteria. It has been identified in several species including Mycobacterium tuberculosis, Mycobacterium bovis, and Mycobacterium marinum, all of which are pathogenic slow-growing mycobacteria . The protein derives its name from the conserved Pro-Pro-Glu (PPE) motif found at the N-terminal region, which is characteristic of this protein family . These proteins are considered key factors in host-pathogen interactions and are notably more abundant in pathogenic mycobacteria compared to non-pathogenic species . PPE13 specifically has been characterized for its role in inflammasome activation during mycobacterial infection.

What structural domains are present in PPE13 and how do they relate to its function?

PPE13 contains multiple structural domains that contribute to its biological activity, most significantly the C-terminal repetitive MPTR (major polymorphic tandem repeat) domain . This MPTR domain has been demonstrated to be essential for PPE13's interaction with the NLRP3 inflammasome . In experimental studies, the MPTR domain specifically interacts with the LRR (leucine-rich repeat) and NATCH domains of NLRP3, facilitating the assembly of the inflammasome complex . This structural interaction is crucial for the downstream inflammatory cascade involving caspase-1 activation and IL-1β secretion. The N-terminal PPE motif serves as a conserved signature sequence, while the C-terminal MPTR domain appears to be the functional component that mediates host protein interactions.

How do researchers typically express recombinant PPE13 for experimental studies?

For experimental studies of PPE13, researchers typically use several expression systems. The most common approach involves heterologous expression in Mycobacterium smegmatis, a non-pathogenic and fast-growing mycobacterial species that serves as an excellent surrogate host . This approach allows for the study of PPE13 in a mycobacterial cellular context without the biosafety concerns associated with pathogenic species. Researchers construct recombinant M. smegmatis expressing PPE13 (often referred to as Ms-PPE13 in literature) using appropriate mycobacterial expression vectors . Alternative approaches include lentiviral vector systems to introduce PPE13 into macrophage cell lines for direct study of host-pathogen interactions . This method is particularly useful for isolating the effects of PPE13 from other mycobacterial components when studying inflammasome activation mechanisms.

What is the mechanism by which PPE13 activates the NLRP3 inflammasome?

PPE13 activates the NLRP3 inflammasome through a direct protein-protein interaction mechanism. Specifically, PPE13 interacts with the LRR and NATCH domains of NLRP3, which facilitates the assembly of the inflammasome complex . This interaction is mediated by the C-terminal repetitive MPTR domain of PPE13, which has been identified as essential for NLRP3 binding . The formation of this complex subsequently activates caspase-1, leading to the proteolytic processing of pro-IL-1β into its mature form . Additionally, PPE13 enhances the cleavage of gasdermin D (GSDMD) into GSDMD-NT (p30), which translocates to the cell membrane to form pores (10-15 nm), resulting in membrane leakage and ultimately pyroptosis . Interestingly, comparative studies have shown that while Ms-Vec (vector control) induces higher GSDMD expression than Ms-PPE13 after 48 hours of culture, the amount of IL-1β released through GSDMD pores is greater in the Ms-PPE13 group, suggesting that PPE13 enhances the efficiency of inflammasome-mediated responses rather than simply increasing protein expression .

How does PPE13-induced inflammasome activation differ from other PE/PPE family proteins?

PPE13's inflammasome activation mechanism exhibits distinct characteristics compared to other PE/PPE family members. While several PE/PPE proteins can modulate immune responses through interaction with toll-like receptors (TLRs), PPE13 specifically targets the NLRP3 inflammasome complex . Unlike PE/PPE proteins such as PE9-PE10, PPE39, and PE_PGRS5 that interact primarily with TLR4, or others like PPE26, PPE32, PPE57, PPE65, and PE_PGRS33 that engage TLR2, PPE13 directly binds to NLRP3 component proteins . This direct interaction with inflammasome machinery rather than upstream pattern recognition receptors represents a distinct inflammatory pathway. Additionally, while some PE/PPE proteins primarily induce apoptosis (like PPE32 and PE_PGRS5) or inhibit apoptosis (like PE_PGRS62 and PE_PGRS18), PPE13 predominantly drives pyroptosis through gasdermin D activation . This highlights the functional diversity within the PE/PPE family despite their structural similarities.

What experimental approaches can be used to study PPE13's role in macrophage pyroptosis?

Studying PPE13's role in macrophage pyroptosis requires multifaceted experimental approaches. First, researchers can utilize genetic engineering to create recombinant Mycobacterium smegmatis expressing PPE13 (Ms-PPE13) for infection studies with macrophage cell lines such as J774A.1, bone marrow-derived macrophages (BMDMs), or THP-1 cells . Alternatively, lentiviral vectors can be employed to directly introduce PPE13 into macrophages, isolating its effects from other mycobacterial components . For measuring pyroptosis, researchers typically assess several parameters: (1) IL-1β secretion using ELISA; (2) caspase-1 activation through western blotting for cleaved caspase-1; (3) GSDMD cleavage to GSDMD-NT (p30) via western blotting; and (4) membrane integrity using lactate dehydrogenase (LDH) release assays . Additionally, real-time imaging of cell membrane pore formation can be conducted using membrane-impermeable fluorescent dyes. Comparative studies with knockout models (NLRP3-/-, caspase-1-/-, or GSDMD-/- macrophages) can confirm the specific pathways involved in PPE13-induced pyroptosis and distinguish it from other forms of cell death like apoptosis or necrosis.

How do the structural characteristics of the MPTR domain contribute to PPE13's interaction with NLRP3?

The MPTR (major polymorphic tandem repeat) domain in PPE13 plays a crucial role in its interaction with NLRP3 through specific structural properties. This C-terminal domain contains repetitive sequences that create multiple potential binding sites for NLRP3's LRR and NATCH domains . The repetitive nature of the MPTR domain likely enables multiple low-affinity interactions that collectively provide high-avidity binding to NLRP3, facilitating stable complex formation . Molecularly, the interaction appears to involve both conformational recognition and specific amino acid contacts that promote inflammasome assembly . Research suggests that the polymorphic nature of these repeats may also contribute to strain-specific variations in inflammasome activation potency across different mycobacterial species . Experimental approaches to study this interaction include co-immunoprecipitation assays, yeast two-hybrid screening, and in vitro binding studies with recombinant protein domains . Structural biology techniques such as X-ray crystallography or cryo-electron microscopy could further elucidate the precise molecular interface between the MPTR domain and NLRP3 components, though such structural data remains limited for PE/PPE family proteins due to their complex repetitive regions.

What cell culture systems are most appropriate for studying PPE13 functions?

Several cell culture systems have proven effective for investigating PPE13 functions, each with specific advantages depending on research objectives. Murine macrophage cell lines such as J774A.1 offer consistency and ease of culture for initial characterization of PPE13-induced inflammasome activation . Human THP-1 monocytic cell lines, which can be differentiated into macrophage-like cells using phorbol 12-myristate 13-acetate (PMA), provide a human-relevant system for translational studies . For primary cell work, bone marrow-derived macrophages (BMDMs) isolated from mice represent a physiologically relevant model that maintains many characteristics of tissue macrophages . When designing experiments, researchers should consider using multiple cell types to ensure robust findings, as PPE13's effects may vary across different macrophage populations. Additionally, NLRP3 knockout cell lines generated through CRISPR-Cas9 or from knockout mice serve as essential negative controls to confirm the specificity of PPE13's actions . For studying the direct effects of PPE13 without confounding factors from other mycobacterial components, lentiviral transduction systems that deliver the PPE13 gene directly into macrophages have proven particularly valuable .

What are the recommended methods for detecting and measuring inflammasome activation induced by PPE13?

Comprehensive assessment of PPE13-induced inflammasome activation requires multiple complementary techniques. For measuring IL-1β secretion, enzyme-linked immunosorbent assay (ELISA) of cell culture supernatants provides quantitative data on the final output of inflammasome activation . Western blotting for cleaved caspase-1 (p20/p10) and the mature form of IL-1β (p17) in both cell lysates and supernatants demonstrates the processing of these proteins . Immunoblotting for GSDMD cleavage to detect the active N-terminal fragment (GSDMD-NT or p30) is essential for confirming pyroptotic pathway activation . Real-time inflammasome assembly can be visualized using confocal microscopy with fluorescently tagged NLRP3, ASC, and caspase-1, allowing dynamic assessment of complex formation . Flow cytometry using fluorescent caspase-1 substrates (such as FLICA) enables quantification of caspase-1 activity at the single-cell level. For functional outcomes of inflammasome activation, lactate dehydrogenase (LDH) release assays measure cell membrane integrity loss during pyroptosis, while propidium iodide uptake assays visualize membrane pore formation . Finally, quantitative PCR for NLRP3, caspase-1, and IL-1β mRNA expression can determine whether PPE13 affects the transcriptional priming stage of inflammasome activation in addition to complex assembly.

How can researchers effectively produce and purify recombinant PPE13 protein for in vitro studies?

Producing and purifying recombinant PPE13 presents several technical challenges due to its structural properties. A recommended approach begins with gene optimization for the expression system of choice, typically Escherichia coli BL21(DE3) with codon optimization for bacterial expression . The PPE13 gene should be cloned into a suitable expression vector containing an affinity tag (such as 6xHis or GST) to facilitate purification. Expression conditions require careful optimization, with lower temperatures (16-18°C) and reduced inducer concentrations often yielding better results by minimizing inclusion body formation . For solubility enhancement, fusion partners such as maltose-binding protein (MBP) or small ubiquitin-like modifier (SUMO) can be employed. Purification typically involves a multi-step process starting with affinity chromatography using the appropriate resin (Ni-NTA for His-tagged proteins), followed by size exclusion chromatography to ensure homogeneity. For PPE13's MPTR domain, which contains repetitive sequences that may cause aggregation, inclusion of detergents or stabilizing agents in the purification buffers can improve yields. Quality control should include SDS-PAGE, western blotting with anti-PPE13 antibodies, and mass spectrometry to confirm protein identity and integrity. For functional validation, the purified protein should be tested for its ability to activate NLRP3 inflammasome in cell culture before use in detailed mechanistic studies.

How might PPE13 research contribute to understanding tuberculosis pathogenesis?

PPE13 research offers several critical insights into tuberculosis pathogenesis. As a potent activator of the NLRP3 inflammasome, PPE13 likely contributes to the inflammatory environment during mycobacterial infection, potentially influencing granuloma formation and maintenance . The protein's ability to induce IL-1β secretion may represent a double-edged sword in tuberculosis progression: while moderate inflammation is necessary for bacterial containment, excessive inflammation can lead to tissue damage and disease exacerbation . Understanding how PPE13 balances between protective immunity and pathological inflammation could explain aspects of tuberculosis immunopathology. Additionally, PPE13's induction of macrophage pyroptosis through gasdermin D activation may represent a bacterial strategy to escape intracellular containment and disseminate, or alternatively, a host defense mechanism to eliminate infected cells and expose bacteria to extracellular immune components . The conservation of PPE13 across pathogenic mycobacterial species (M. tuberculosis, M. bovis, and M. marinum) suggests evolutionary importance in virulence . Comparative studies of PPE13 variants across clinical isolates, particularly between drug-resistant and drug-sensitive strains, could reveal correlations between PPE13 structure/function and disease outcomes. This research direction may ultimately identify PPE13 as a potential target for host-directed therapies aimed at modulating excessive inflammation in tuberculosis.

How can comparative studies of PPE13 across different mycobacterial species inform tuberculosis research?

Comparative studies of PPE13 across different mycobacterial species offer valuable insights into tuberculosis research through evolutionary and functional perspectives. PPE13 proteins have been identified in M. tuberculosis, M. bovis, and M. marinum, all capable of activating the NLRP3 inflammasome through similar mechanisms involving their MPTR domains . Sequence analysis of PPE13 homologs across these species can identify conserved regions likely critical for function versus variable regions that may contribute to host-adaptation or species-specific virulence strategies . Functional comparisons using recombinant expression of PPE13 variants from different species in standardized experimental systems could reveal quantitative differences in inflammasome activation potency or qualitative differences in downstream effects . Of particular interest is comparing PPE13 from M. tuberculosis (human pathogen) with that from M. bovis (primarily animal pathogen with zoonotic potential) to understand host-specific adaptations. Additionally, examining PPE13 in M. marinum (fish and amphibian pathogen often used as a tuberculosis model) could provide insights into evolutionarily conserved mechanisms across different host environments . The presence or absence of PPE13 homologs in non-pathogenic mycobacteria like M. smegmatis or M. vaccae may further illuminate its role in virulence . These comparative approaches could ultimately identify universal versus species-specific aspects of PPE13 function that inform both fundamental mycobacterial biology and potential translational applications in tuberculosis prevention or treatment.

What statistical approaches are recommended for analyzing PPE13-induced inflammasome activation data?

Analyzing PPE13-induced inflammasome activation data requires robust statistical approaches tailored to the experimental design and data characteristics. For comparing IL-1β secretion levels or caspase-1 activation between experimental groups (e.g., Ms-PPE13 vs. Ms-Vec), parametric tests such as Student's t-test (for two groups) or one-way ANOVA with appropriate post-hoc tests (for multiple groups) are typically employed assuming normal distribution . When data violates normality assumptions, non-parametric alternatives like Mann-Whitney U test or Kruskal-Wallis test should be used. For time-course experiments examining the kinetics of inflammasome activation, repeated measures ANOVA or mixed-effects models are more appropriate to account for within-subject correlations . Dose-response relationships between PPE13 concentration and inflammasome activation metrics can be analyzed using regression models to determine EC50 values. When examining multiple output variables simultaneously (e.g., IL-1β secretion, caspase-1 activation, and GSDMD cleavage), multivariate analysis techniques such as principal component analysis may reveal patterns not apparent in univariate analyses. For cell death assays measuring pyroptosis, survival analysis methods may be applicable when tracking individual cell fates over time. Researchers should report effect sizes alongside p-values to indicate biological significance, and implement appropriate corrections for multiple comparisons (e.g., Bonferroni or false discovery rate) when conducting numerous statistical tests . Power analysis prior to experimentation helps ensure sufficient sample sizes to detect biologically relevant effects of PPE13 on inflammasome activation.

How should researchers interpret contradictory data regarding PPE13's effects on different cell types?

When encountering contradictory data regarding PPE13's effects across different cell types, researchers should implement a systematic interpretive framework. First, consider intrinsic differences in inflammasome regulation between cell types: human THP-1 cells, murine J774A.1 cells, and primary BMDMs have distinct baseline NLRP3 expression levels and priming requirements that may explain differential responses to PPE13 . Second, examine the activation state of cells before PPE13 exposure, as NLRP3 inflammasome requires priming (Signal 1) before activation (Signal 2), and some cell types may lack adequate priming in certain experimental conditions . Third, analyze the experimental timing, as PPE13's effects may manifest differently across acute versus prolonged exposure periods. Fourth, consider species-specific differences when comparing human versus murine cells, as subtle variations in NLRP3 structure may affect PPE13 binding affinity . Fifth, assess methodological variations between studies, including PPE13 delivery method (recombinant M. smegmatis expression versus lentiviral transduction), protein concentration, and purity . Sixth, evaluate the readouts used to measure inflammasome activation, as different metrics (IL-1β secretion, caspase-1 cleavage, pyroptosis) may yield seemingly contradictory results if only subset of the inflammasome pathway is affected. Finally, researchers should thoroughly report experimental conditions and acknowledge limitations of their models, working toward integrative explanations that accommodate apparently contradictory observations rather than dismissing outlier results that may reveal important biological nuances of PPE13 function.

What is the recommended approach for distinguishing between correlation and causation in PPE13 inflammasome studies?

Distinguishing between correlation and causation in PPE13 inflammasome studies requires rigorous experimental approaches and careful data interpretation. Researchers should implement a multi-faceted strategy starting with genetic manipulation techniques: CRISPR-Cas9 knockout of NLRP3, ASC, caspase-1, or GSDMD in macrophages prior to PPE13 exposure can establish necessary causal relationships . Complementing genetic approaches, pharmacological inhibition using specific NLRP3 inhibitors (MCC950), caspase-1 inhibitors (VX-765/Z-YVAD-FMK), or GSDMD inhibitors provides orthogonal validation of pathway dependencies . Structure-function analyses using PPE13 mutants with specific domain deletions or point mutations, particularly in the MPTR domain, can establish direct causative links between protein structural features and inflammasome activation . Temporal studies tracking the sequence of events (PPE13 binding to NLRP3, inflammasome assembly, caspase-1 activation, IL-1β processing, GSDMD cleavage, pyroptosis) are essential to establish cause-effect relationships rather than mere associations . Dose-response experiments demonstrating proportional relationships between PPE13 concentration and inflammasome activation strengthen causal claims. Direct protein-protein interaction studies (co-immunoprecipitation, proximity ligation assays) confirm physical associations underlying functional effects . Finally, researchers should design experiments that can falsify their causal hypotheses rather than merely supporting them, and consider alternative explanations for observed phenomena. By combining these approaches, investigators can move beyond correlative observations to establish robust causal frameworks for understanding PPE13's role in inflammasome biology.

Comparative analysis of PPE13 effects across different experimental systems

Experimental SystemIL-1β SecretionCaspase-1 ActivationGSDMD CleavageCell Death PhenotypeReference
Ms-PPE13 in J774A.1EnhancedIncreased cleavagePresentPyroptosis
Ms-PPE13 in BMDMsEnhancedIncreased cleavagePresentPyroptosis
Ms-PPE13 in THP-1EnhancedIncreased cleavagePresentPyroptosis
Lentiviral PPE13 in macrophagesEnhancedIncreased cleavageNot reportedNot fully characterized
Ms-Vec (control)BaselineMinimalHigher expression but less cleavedLimited pyroptosis

This table summarizes the key experimental findings on PPE13-induced inflammasome activation across different experimental systems. The data consistently demonstrates that PPE13 enhances IL-1β secretion and caspase-1 activation across multiple macrophage cell types . Interestingly, while Ms-Vec induced higher total GSDMD expression than Ms-PPE13 after 48 hours of culture, Ms-PPE13 generated more cleaved GSDMD-NT (p30) and caused greater IL-1β release through membrane pores, indicating more efficient inflammasome activation and pyroptosis induction . These findings collectively establish PPE13 as a direct activator of the NLRP3 inflammasome cascade across diverse experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.