Recombinant Uncharacterized PPE family protein PPE45 (ppe45)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted based on customer needs.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-408
Protein Length
full length protein
Target Names
ppe45
Target Protein Sequence
MDFGVLPPEINSGRMYAGPGSGPMMAAAAAWDSLAAELGLAAGGYRLAISELTGAYWAGP
AAASMVAAVTPYVAWLSATAGQAEQAGMQARAAAAAYELAFAMTVPPPVVVANRALLVAL
VATNFFGQNTPAIAATEAQYAEMWAQDAAAMYAYAGSAAIATELTPFTAAPVTTSPAALA
GQAAATVSSTVPPLATTAAVPQLLQQLSSTSLIPWYSALQQWLAENLLGLTPDNRMTIVR
LLGISYFDEGLLQFEASLAQQAIPGTPGGAGDSGSSVLDSWGPTIFAGPRASPSVAGGGA
VGGVQTPQPYWYWALDRESIGGSVSAALGKGSSAGSLSVPPDWAARARWANPAAWRLPGD
DVTALRGTAENALLRGFPMASAGQSTGGGFVHKYGFRLAVMQRPPFAG
Uniprot No.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
