Recombinant Uncharacterized PPE family protein PPE66 (ppe66)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Target Names
ppe66
Target Protein Sequence
MTTAYASALAAMPTLTELAANHTSHAVLLGTNFFGINTIPIALNEADYARMWIQAATTMS IYEGTSDAALASAPQTTPAPVLFNGGAGVASALPAISAATLDPASIIGIIIEILIQLFLI SLEILFAIVAYTIIIVLILPLVIFAYAIVFAVLAIIFGPPLLVIASPFVLTGSVIAVPTS LSTSLSTAVPIGVGQYLADLASADAQAIEVGLKTADVAPVAVRPAAAPPLRESAAVRPEA RLVSAVAPAPAGTSASVLASDRGAGVLGFAGTAGKESVGRPAGLTTLAGGEFGGSPSVPM VPASWEQLVGAGEAG
Uniprot No.

Q&A

What is the PPE family of proteins and how does PPE66 fit within this classification?

The PPE family proteins are a group of proteins found predominantly in mycobacterial species, including Mycobacterium tuberculosis. They are characterized by a conserved N-terminal Pro-Pro-Glu (PPE) motif. PPE66 is an uncharacterized member of this family, sharing structural similarities with other PPE proteins. The PE/PPE family proteins have been implicated in various immunological effects, including modulation of host cell responses such as apoptosis and inflammatory pathways . Like other PPE proteins, PPE66 likely plays roles in bacterial pathogenesis and host-pathogen interactions, though its specific functions remain to be elucidated through targeted research approaches.

Why are PPE family proteins significant in mycobacterial research?

PPE family proteins are significant in mycobacterial research for several reasons. First, they represent approximately 10% of the coding capacity of the M. tuberculosis genome, suggesting important biological functions. Second, research has demonstrated that various PE/PPE proteins participate in critical pathogenesis mechanisms, including modulation of host immune responses, manipulation of apoptotic pathways, and contribution to bacterial survival within host cells . For example, some PPE proteins like PPE10 (Rv0442c) have been shown to inhibit apoptosis in host cells, potentially promoting bacterial persistence and contributing to the chronic nature of tuberculosis infections . Understanding uncharacterized PPE proteins like PPE66 may reveal novel virulence factors and potential therapeutic targets.

How can researchers overcome challenges in purifying recombinant PPE66?

Purification of recombinant PPE proteins often presents challenges due to their hydrophobic nature and tendency to form inclusion bodies. A methodological approach to overcome these challenges includes:

  • Solubilization of inclusion bodies using 8 M urea as demonstrated with other recombinant proteins

  • Affinity chromatography using histidine tags for initial purification

  • Refolding protocols through gradual dialysis to remove denaturants

  • Size exclusion chromatography for further purification

Researchers should verify protein identity through Western blot analysis using anti-His tag antibodies, looking for bands at the expected molecular weight . Additionally, optimizing expression conditions (temperature, IPTG concentration, induction time) can improve solubility. For validation of proper folding, circular dichroism spectroscopy and limited proteolysis assays can be employed to ensure the purified protein maintains its native structure.

What strategies can improve the solubility of recombinant PPE66?

Several strategies can improve the solubility of recombinant PPE66:

  • Fusion tags: Utilizing solubility-enhancing tags such as MBP (maltose-binding protein), SUMO, or Thioredoxin

  • Co-expression with chaperones: GroEL/GroES or DnaK/DnaJ/GrpE chaperone systems can assist proper folding

  • Expression conditions: Lower temperature (16-18°C), reduced IPTG concentration, and slower induction

  • Solubility screening: Testing multiple buffer conditions using a factorial design approach

  • Directed evolution: Generating solubility-enhanced variants through random or site-directed mutagenesis

These approaches have proven successful with difficult-to-express proteins and can be systematically evaluated to determine the optimal conditions for PPE66 solubility and activity. Monitoring protein behavior in various detergents and stabilizing agents can provide additional insights into maintaining the protein in solution post-purification.

What computational approaches can predict the function of uncharacterized PPE66?

Multiple computational approaches can help predict the function of uncharacterized proteins like PPE66:

  • Homology-based annotation: Utilizing tools like Pfam, InterPro, CATH, SUPERFAMILY, and SMART to identify conserved domains and functional motifs

  • Protein-protein interaction prediction: Using STRING database to infer biological functions within protein networks

  • Tertiary structure modeling: Employing SWISS-MODEL server for homology-based structure prediction to suggest function based on structural similarities

  • Sequence-based analysis: Multiple sequence alignments with characterized PPE proteins to identify conserved residues potentially important for function

  • Subcellular localization prediction: Tools to predict cellular localization, providing clues to potential functions

In a study on hypothetical proteins from Bacillus paralicheniformis, researchers successfully attributed functions to 37 out of 414 hypothetical proteins using similar in-silico approaches, achieving 98% accuracy in tool performance . Such methodologies could be applied to predict PPE66 function, generating testable hypotheses for experimental validation.

How can immunological properties of PPE66 be systematically assessed?

Systematic assessment of PPE66 immunological properties can be conducted through:

  • Macrophage infection models: Using cell lines like THP-1 or RAW264.7 to evaluate effects on:

    • Apoptosis rates (via flow cytometry)

    • Expression of apoptotic markers (Bax, CytC, caspase-3/7/9)

    • Proinflammatory cytokine production (IL-1β, IL-6, IL-12)

    • Host cell signaling pathways (NF-κB, PPAR)

  • Protein challenge experiments: Treating macrophages with purified PPE66 at different concentrations (5-10 μg/mL) to assess concentration-dependent effects, similar to studies with PE6 protein

  • Transcriptomic analysis: RNA-sequencing to detect global changes in host gene expression upon PPE66 exposure

  • Specific pathway investigation: Analysis of ER stress markers (CHOP, p-PERK, p-eIF2α) and inflammasome components (NLRP3, caspase-1/4, GSDMD) that may be modulated by PPE66

These approaches would generate comprehensive data on how PPE66 interacts with host immune cells, potentially revealing its role in mycobacterial pathogenesis.

What techniques are effective for validating predicted functions of PPE66?

Validating predicted functions of PPE66 requires multiple complementary approaches:

  • Gene knockout/knockdown studies: Creating PPE66-deficient mycobacterial strains to assess phenotypic changes

  • Complementation experiments: Reintroducing PPE66 to confirm phenotype restoration

  • Domain mutation analysis: Introducing targeted mutations in predicted functional domains to assess their importance

  • Protein-protein interaction verification: Using pull-down assays, co-immunoprecipitation, or yeast two-hybrid systems to confirm predicted interactions

  • In vivo infection models: Using animal models to assess virulence and immunomodulatory effects of wild-type versus PPE66-deficient strains

Validation requires careful experimental design with appropriate controls. For example, when studying immunomodulatory effects, comparisons should include both wild-type and mutant proteins, as well as unrelated proteins as negative controls to ensure observed effects are specific to PPE66 function.

How might PPE66 interact with host immune pathways compared to characterized PPE proteins?

Based on studies of other PPE family proteins, PPE66 may interact with host immune pathways in several distinct ways:

  • Apoptosis modulation: Some PPE proteins promote apoptosis (like PE6) by increasing proapoptotic proteins Bax and CytC and activating caspase-3, while others (like PPE10) inhibit apoptosis by decreasing caspase-3/7/8 expression and Bax transcription . PPE66 could be systematically assessed for either pro- or anti-apoptotic activity.

  • Inflammatory response regulation: PPE60 has been shown to inhibit PPARγ transcription, leading to upregulation of proinflammatory cytokines . PPE66 may similarly modulate inflammatory signaling pathways, potentially through interaction with transcription factors like NF-κB.

  • Pyroptosis pathway engagement: Some PPE proteins increase expression of pyroptosis molecules such as caspase-1/4, NLRP3, and GSDMD . PPE66 should be evaluated for effects on pyroptotic cell death pathways.

  • ER stress induction: PE6 induces ER stress-related responses by increasing levels of unfolded proteins and stress markers CHOP, p-PERK, and p-eIF2α . PPE66 could be assessed for similar effects on cellular stress responses.

Systematic comparative studies measuring these pathways in parallel would position PPE66 within the functional spectrum of PPE family proteins.

What potential roles might PPE66 play in vaccine development against mycobacterial infections?

PPE66 could have significant potential in vaccine development against mycobacterial infections:

  • Antigen selection: As a member of the PPE family, PPE66 may represent a novel antigen target for subunit vaccines. Other mycobacterial proteins have shown promising protection rates in mouse models when formulated as recombinant subunit vaccines .

  • Adjuvant considerations: Studies with other recombinant proteins have shown that choice of adjuvant (such as saponin or aluminum hydroxide) significantly influences the immune response generated by vaccine formulations . For PPE66-based vaccines, adjuvant selection would be critical for optimizing immunogenicity.

  • Combination approaches: Association of multiple recombinant proteins in vaccine formulations has demonstrated enhanced protective efficacy. For example, combining rNanH and rPknG proteins provided 40% protection in a mouse model . PPE66 could be evaluated alone and in combination with other mycobacterial antigens.

  • Immune response characterization: Assessment of antibody production (total IgG, IgG1, IgG2a) and cellular immune responses would be essential to understand the type of immunity (Th1/Th2 balance) generated by PPE66-based vaccines .

  • Delivery strategies: Various delivery platforms (protein nanoparticles, viral vectors, DNA vaccines) could be explored to optimize PPE66 presentation to the immune system.

How can researchers design definitive experiments to resolve conflicting data about PPE66 function?

When faced with conflicting data about PPE66 function, researchers should implement the following experimental design strategies:

  • Standardized experimental conditions: Use consistent:

    • Cell lines and passage numbers

    • Protein concentrations and purification methods

    • Incubation times and assay conditions

    • Defined medium compositions

  • Multiple methodological approaches: Employ complementary techniques to assess the same biological outcome:

    • For apoptosis: Flow cytometry, TUNEL assay, caspase activity, and Western blotting for apoptotic markers

    • For immune modulation: ELISA, multiplex cytokine assays, and transcriptomic analysis

  • Dose-response and time-course experiments: Systematically vary:

    • PPE66 concentrations (e.g., 5 μg/mL, 7.5 μg/mL, 10 μg/mL)

    • Exposure times (6h, 24h, 48h)

    • Cell activation states (resting vs. stimulated)

  • Genetic approaches: Implement:

    • CRISPR-based genetic screens to identify host factors required for PPE66 function

    • Structure-function analysis with truncated or mutated versions of PPE66

  • Independent validation: Collaborate with independent laboratories to reproduce key findings under blinded conditions

  • Statistical rigor: Employ appropriate statistical methods with adequate sample sizes, determined through power analysis, and control for multiple comparisons when performing high-throughput experiments.

How can structural biology approaches enhance understanding of PPE66 function?

Structural biology approaches can significantly enhance understanding of PPE66 function through:

These approaches, combined with computational modeling and molecular dynamics simulations, can generate testable hypotheses about PPE66 function. For instance, identification of conserved surface patches might suggest binding interfaces, while structural homology to proteins of known function could indicate potential biochemical activities.

What interdisciplinary collaborations would accelerate PPE66 research?

Accelerating PPE66 research would benefit from the following interdisciplinary collaborations:

  • Structural biologists and computational biologists: Combining experimental structure determination with in silico modeling and function prediction .

  • Immunologists and cell biologists: Investigating PPE66 effects on host immune cells, leveraging expertise in specialized assays for immune function and cell signaling pathway analysis .

  • Microbiologists and geneticists: Creating knockout/complementation strains and performing transcriptomic studies to understand the role of PPE66 in bacterial physiology.

  • Biochemists and protein engineers: Optimizing expression and purification protocols, and potentially engineering more soluble variants for functional studies .

  • Systems biologists: Integrating multi-omics data to position PPE66 within broader bacterial and host response networks.

  • Vaccine developers and immunization experts: Translating basic knowledge about PPE66 into potential vaccine applications, drawing on expertise in formulation, adjuvant selection, and immune response evaluation .

Successful collaborations require clear communication of project goals, regular sharing of data and resources, and integrated experimental design to ensure complementary approaches address key research questions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.