Recombinant Uncharacterized protein B0310.1 (B0310.1)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics and Structure

Uncharacterized protein B0310.1 is a protein found in the nematode Caenorhabditis elegans, a model organism widely used in molecular biology and genetics research. The recombinant form of B0310.1 is produced using Escherichia coli as an expression host, allowing for controlled production of the protein for research purposes. The full-length protein consists of 292 amino acids and is typically produced with a histidine tag to facilitate purification and detection in laboratory settings .

The structural properties of B0310.1 remain largely undefined in the current literature. Unlike many characterized proteins, B0310.1 lacks comprehensive structural analysis through techniques such as X-ray crystallography or nuclear magnetic resonance spectroscopy. This gap in structural knowledge represents a significant opportunity for future research initiatives that could shed light on the protein's three-dimensional configuration and potential functional domains.

The recombinant form of B0310.1 available from commercial sources is presented in the following specification table:

ParameterSpecification
Catalog NumberRFL26744CF
Product NameRecombinant Full Length Uncharacterized Protein B0310.1
Source (Host)E. coli
SpeciesCaenorhabditis elegans
TagHis
Protein LengthFull Length (1-292)

This commercially available recombinant form provides researchers with access to the protein for various experimental applications, though the limited characterization information suggests that much remains to be discovered about this protein .

Research Status and Functional Hypotheses

The current research status of B0310.1 is characterized by significant knowledge gaps. Unlike many proteins in model organisms, B0310.1 has not been extensively studied in terms of its biological functions, interactions, or regulatory roles. Commercial databases that offer the recombinant protein contain empty tables for pathway involvement, protein function, and interacting proteins, highlighting the limited research conducted on this particular protein .

In the broader context of C. elegans research, studies on protein function often focus on cellular processes such as endosomal trafficking, as demonstrated in research on other C. elegans proteins like SAND-1 . While B0310.1 has not been implicated in such processes based on the available search results, these types of cellular mechanisms represent potential functional areas that could be explored in future research.

The paucity of information specifically about B0310.1 presents a challenge for researchers interested in this protein but also an opportunity to make significant contributions to the understanding of its role in C. elegans biology. Hypothesis-generating experiments, such as expression pattern analysis, knockout studies, or interactome mapping, could help establish initial functional characterizations.

Experimental Applications and Research Methods

Recombinant uncharacterized proteins like B0310.1 serve various purposes in experimental settings, despite limited knowledge about their natural functions. These applications include:

  1. Antibody production: The recombinant protein can be used to generate antibodies for detection and localization studies in C. elegans.

  2. Interaction studies: Pull-down assays, yeast two-hybrid screens, or co-immunoprecipitation experiments could reveal binding partners and provide functional insights.

  3. Expression pattern analysis: Determining when and where B0310.1 is expressed in C. elegans could offer clues about its physiological role.

  4. Structural studies: Purified recombinant B0310.1 could be subjected to structural analysis techniques to determine its three-dimensional configuration.

The methodological approaches used in C. elegans protein research often involve advanced techniques like microinjection of markers into the body cavity and tracking their movement through various cellular compartments . Similar approaches could be applied to study B0310.1, potentially revealing its subcellular localization and trafficking patterns.

Comparison with Other Uncharacterized Proteins

Research on uncharacterized proteins represents a significant frontier in proteomics. The challenges faced in studying B0310.1 are not unique but rather reflect a broader issue in protein science: many predicted proteins from genome sequencing projects remain functionally uncharacterized.

In the context of Mycobacterium tuberculosis research, for example, studies have made progress in characterizing previously uncharacterized proteins such as Rv3124, which was found to function as a transcriptional regulator of molybdopterin biosynthesis . This example demonstrates how uncharacterized proteins can eventually be assigned specific functions through focused research efforts.

Similarly, in clinical research contexts, novel compounds derived from proteins with previously unknown functions can find applications in therapeutic development. For instance, BPM31510, though not directly related to B0310.1, represents how proteins and their derivatives can transition from uncharacterized status to potential clinical applications .

These examples provide templates for how research on B0310.1 might progress from its current uncharacterized state to a protein with defined functions and potential applications.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will prepare according to your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for the estimated delivery time.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
B0310.1; Uncharacterized protein B0310.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
B0310.1
Target Protein Sequence
MGADLPPKFQYAFRRCLFYTFVLVAWLFIGMILFPALCTPAVKQDDNEAGIFRLDAKRSD LLNVLWAETITNGEDDWSELADQKLELYEKALLQHYGIDLDKSDKSFASGLQKSFAISTT IGPLDVDDFTTLGKLIAVLYALIGTPLFLTVIGQLGKMVTSVWQGTTLWIVTIVYIFISA VIYDIVEGGSDDVPFIEAIFSIFLQFTTVGEVDNEFHGVLPYCIVVLGLALITALYQEMQ HNIERFIHPFEYSFNRLCGNVERWAGEKSEDKKSIVTSRIEEENEDEISDYE
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_B0310.1

STRING: 6239.B0310.1b

UniGene: Cel.11530

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Uncharacterized protein B0310.1 and what organism does it originate from?

Uncharacterized protein B0310.1 is a full-length protein (292 amino acids) from the nematode Caenorhabditis elegans. It is cataloged in the UniProt database under accession number Q10937, with the gene name designation B0310.1. This protein represents one of many proteins in C. elegans whose specific biological functions remain to be fully elucidated through experimental investigation . As an uncharacterized protein, B0310.1 presents significant research opportunities for determining its structural properties, binding partners, and potential roles in cellular processes within this model organism.

What are the optimal storage conditions for recombinant B0310.1 protein?

For recombinant B0310.1 protein, the following storage conditions are recommended for maintaining stability and biological activity:

Storage PurposeRecommended ConditionAdditional Notes
Long-term storage-20°C or -80°CFor extended preservation
Working stock4°CViable for up to one week
Buffer compositionTris-based buffer with 50% glycerolOptimized specifically for B0310.1

It is strongly advised to avoid repeated freeze-thaw cycles as this can lead to protein degradation and loss of activity. Creating working aliquots upon first thawing is recommended to minimize structural damage to the protein .

What proteomics approaches are most effective for studying uncharacterized proteins like B0310.1?

When designing proteomics experiments to study uncharacterized proteins like B0310.1, researchers should consider a multi-faceted approach:

  • Sample Preparation Optimization: The complexity of proteomes requires careful experimental design. For uncharacterized proteins, which may be expressed at low abundance, protein separation techniques prior to MS analysis are crucial. Both liquid chromatography (LC) and gel electrophoresis can be effective, with the choice depending on the specific research question .

  • Protein Abundance Considerations: Understanding the potential abundance distribution of the protein is essential. While tissue proteins typically follow a bell-shaped distribution spanning approximately six orders of magnitude, body fluid proteins may cover a wider range (>10 orders of magnitude). For uncharacterized proteins like B0310.1, initial experiments should consider both possibilities to ensure detection .

  • Mass Spectrometry Parameters: Computer simulations reveal that three critical factors significantly impact experimental success rates:

    • Degree of protein separation prior to analysis

    • MS detection limit

    • MS dynamic range

Studies show that improving protein separation before enhancing detection sensitivity delivers superior results compared to improving MS dynamic range first .

How can researchers determine potential binding partners of B0310.1?

To identify potential interaction partners of uncharacterized proteins like B0310.1, researchers should employ complementary methodologies:

  • Co-immunoprecipitation followed by MS: This approach can be modeled after techniques used for other uncharacterized proteins. For example, studies of the SANBR protein (another previously uncharacterized protein) revealed interactions with corepressor proteins including HDAC and SMRT through its BTB domain . For B0310.1, a similar approach could identify binding partners that might suggest functional roles.

  • Yeast Two-Hybrid Screening: This technique can identify direct protein-protein interactions, particularly useful for uncharacterized proteins with no known function.

  • Proximity-Dependent Biotin Identification (BioID): This method involves fusing B0310.1 to a biotin ligase, allowing biotinylation of proximate proteins in the cellular environment, which are then purified and identified by MS.

  • Cross-Linking Mass Spectrometry: This technique can capture transient interactions by covalently linking proteins in close proximity before MS analysis.

A successful experimental workflow should consider protein separation efficiency. Simulations indicate that separation of proteins into fractions containing equal numbers of proteins (without losses) significantly improves detection of low-abundance interaction partners .

What computational approaches can predict potential functions of B0310.1?

For uncharacterized proteins like B0310.1, computational prediction approaches provide valuable insights that can guide experimental investigations:

  • Structural Homology Modeling: Using the amino acid sequence provided , researchers can generate predictive 3D structural models using platforms like AlphaFold or Rosetta. These models can suggest potential binding pockets or functional domains.

  • Sequence Conservation Analysis: Comparing B0310.1 sequences across nematode species can identify conserved regions likely important for function. The amino acid sequence suggests possible membrane-associated regions, which could indicate roles in transport or signaling.

  • Gene Expression Correlation Networks: Analyzing which genes are co-expressed with B0310.1 in C. elegans under various conditions can suggest functional relationships and potential biological pathways.

  • Machine Learning Classification: Using feature extraction from the amino acid sequence combined with supervised learning algorithms trained on proteins with known functions can predict potential functional categories for B0310.1.

  • Molecular Dynamics Simulations: For predicted structural models, MD simulations can provide insights into protein flexibility, potential conformational changes, and interaction propensities.

The methodological approach should combine multiple prediction methods, as consensus predictions typically provide higher confidence results than any single method alone.

How can researchers optimize mass spectrometry detection for low-abundance proteins like potentially uncharacterized B0310.1?

Mass spectrometry optimization for low-abundance proteins requires strategic adjustments to experimental parameters:

ParameterOptimization StrategyExpected Impact
Sample loadingIncrease peptide material loaded in separation stepAnalogous to improving detection sensitivity
Protein separationImplement pre-MS fractionationReduces complexity, enhances detection of low-abundance proteins
MS detection limitSelect instrument with better sensitivityCritical for detecting low-abundance proteins
MS dynamic rangeEnhance to >3 orders of magnitudeAllows simultaneous detection of high and low abundance peptides
Peptide separationIncrease number of fractionsAnalogous to improving MS dynamic range

Simulations demonstrate that for comprehensive analysis of complex proteomes, researchers should prioritize protein separation first, followed by improvements in detection sensitivity, rather than enhancing MS dynamic range initially. This sequence of optimization produces significantly better success rates for detecting low-abundance proteins .

For studies specifically targeting B0310.1, enrichment strategies such as using epitope-tagged recombinant versions or custom antibodies can dramatically improve detection prospects before mass spectrometry analysis.

What are the methodological considerations for generating C. elegans models to study B0310.1 function?

For functional characterization of B0310.1, researchers can develop C. elegans models using several complementary approaches:

When designing these models, researchers should consider the principles illustrated by studies of other uncharacterized proteins. For example, research on SANBR demonstrated that overexpression inhibited Class Switch Recombination in B cells, and this inhibition was dependent on specific domains (BTB domain was essential while SANT domain was largely dispensable) . Similar domain-function relationships could be explored for B0310.1.

How should researchers approach conflicting experimental results when studying uncharacterized proteins?

When encountering contradictory data during B0310.1 research, a systematic troubleshooting and validation approach is recommended:

  • Experimental Validation Through Multiple Methods: If one approach yields unexpected results, confirm findings using orthogonal techniques. For example, if mass spectrometry suggests certain post-translational modifications, verify using biochemical assays like Western blotting with modification-specific antibodies.

  • Controlled Condition Testing: Systematically vary experimental conditions (temperature, pH, salt concentration) to determine if conflicting results arise from condition-dependent behaviors of the protein.

  • Biological Replicates Analysis: Distinguish between technical variability and true biological differences by performing statistical analysis across multiple biological replicates.

  • Domain-Specific Function Testing: Similar to studies on the SANBR protein, where specific domains were found to have distinct functions (BTB domain required for CSR inhibition, SANT domain largely dispensable) , researchers should test B0310.1 domains separately when functional data appears contradictory.

  • Data Integration Framework: Develop a hierarchical evidence assessment model that weights different experimental approaches based on their reliability and relevance to resolve conflicting data.

What statistical approaches are most appropriate for analyzing proteomics data from studies of B0310.1?

When analyzing proteomics data for uncharacterized proteins like B0310.1, researchers should consider:

  • False Discovery Rate Control: Implement robust FDR control methods for protein identification to minimize false positives, particularly important when studying proteins of unknown function.

  • Abundance Estimation Models: For quantitative studies, use appropriate statistical models that account for the dynamic range challenges in proteomics (tissue proteins span approximately six orders of magnitude in abundance) .

  • Bayesian Frameworks: These are particularly useful for integrating prior knowledge about protein families or domains with new experimental data, allowing for uncertainty quantification.

  • Machine Learning Classification: For large datasets, supervised and unsupervised learning approaches can identify patterns suggesting potential functions.

  • Network Analysis: Statistical approaches for network construction and analysis can place B0310.1 in the context of known protein interaction networks, suggesting functional relationships.

The complexity of proteomes necessitates robust statistical approaches that can account for the wide range of protein abundances and the challenges in comprehensive detection. Computer simulations of experimental designs can help researchers determine which parameters significantly impact outcomes and deserve greater statistical scrutiny .

What emerging technologies show promise for characterizing currently uncharacterized proteins like B0310.1?

Several cutting-edge approaches are revolutionizing the study of uncharacterized proteins:

  • Cryo-Electron Microscopy: Advances in cryo-EM now enable structural determination of proteins that resist crystallization, potentially allowing visualization of B0310.1's structure without requiring crystal formation.

  • Spatial Proteomics: Techniques like APEX labeling or proximity-dependent biotin identification (BioID) can reveal the spatial context of B0310.1 within cells, providing functional insights.

  • Single-Cell Proteomics: Emerging technologies allowing protein analysis at the single-cell level could reveal cell-type-specific functions of B0310.1 that might be masked in whole-organism studies.

  • Integrated Multi-Omics: Combining proteomics with transcriptomics, metabolomics, and genomics data can place B0310.1 within broader biological networks and suggest functions based on correlation patterns.

  • AI-Driven Function Prediction: Machine learning approaches trained on ever-growing protein databases are increasingly accurate at predicting functions of uncharacterized proteins based on sequence patterns.

  • Protein-Protein Interaction Mapping: Advanced techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify not just binding partners but specific interaction interfaces of B0310.1.

Like the approach used to identify SANBR as a negative regulator of Class Switch Recombination , combining genetic screens with biochemical validation represents a powerful strategy for elucidating the functions of uncharacterized proteins like B0310.1.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.