Recombinant Uncharacterized protein B0310.3 (B0310.3)

Shipped with Ice Packs
In Stock

Description

Introduction to B0310.3 Protein

B0310.3 is an uncharacterized protein originally identified in Caenorhabditis elegans (C. elegans), a nematode widely used as a model organism in various fields including neurobiology, developmental biology, and genetics . Despite being classified as "uncharacterized," this protein has garnered research interest, evidenced by its commercial availability as a recombinant protein and associated antibodies for laboratory investigations .

The protein is formally designated as "Uncharacterized protein B0310.3" with the UniProt identification number Q10939 . While its specific biological function remains to be fully elucidated, its structural characteristics and expression profile provide valuable insights for ongoing research.

Physical and Biochemical Properties

The recombinant B0310.3 protein is typically produced with a His-tag, facilitating purification and detection in experimental settings . When expressed and purified, the protein demonstrates the following properties:

PropertySpecificationReference
SpeciesCaenorhabditis elegans
UniProt IDQ10939
Protein LengthFull Length (1-445 amino acids)
Expression RegionComplete protein (1-445)
Molecular WeightNot specified in sources-
Purity>90% as determined by SDS-PAGE

Recombinant Expression

The recombinant B0310.3 protein is primarily expressed in Escherichia coli (E. coli) expression systems . This bacterial expression system provides several advantages for protein production, including high yield, cost-effectiveness, and relatively straightforward purification protocols.

The expression construct typically incorporates an N-terminal His tag, which facilitates purification through affinity chromatography methods . This tag allows for the isolation of the protein with high purity (greater than 90% as determined by SDS-PAGE) .

For lyophilized protein preparations, the following reconstitution protocol is recommended:

  1. Briefly centrifuge the vial prior to opening to bring contents to the bottom

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (default recommendation is 50%)

  4. Aliquot for long-term storage at -20°C/-80°C

This reconstitution approach helps maintain protein stability while minimizing freeze-thaw cycles.

elegans as a Model Organism

The B0310.3 protein originates from C. elegans, which has emerged as an important animal model in various fields including neurobiology, developmental biology, genetics, and toxicology . This nematode offers several advantages as a model organism:

  • Genetic manipulability

  • Well-characterized genome

  • Invariant and fully described developmental program

  • Ease of maintenance

  • Short and prolific life cycle

  • Small body size

These characteristics make C. elegans particularly valuable for studying protein function in a whole-organism context, potentially including investigations of B0310.3.

Current Understanding and Research Gaps

  1. RNA interference (RNAi) studies: C. elegans has a well-established heritable RNAi system that could be utilized to investigate the effects of B0310.3 knockdown

  2. Protein interaction studies: Identifying binding partners could provide clues to B0310.3's function

  3. Expression profiling: Understanding when and where the protein is expressed during development

  4. 3'UTR analysis: Recent comprehensive analysis of 3'UTRs in C. elegans could provide insights into B0310.3 regulation

The fact that commercial antibodies against B0310.3 are available suggests ongoing research interest in this protein .

Available Research Reagents

Several commercial reagents are available to facilitate research on the B0310.3 protein:

Product TypeDescriptionApplicationReference
Recombinant ProteinHis-tagged full-length proteinProtein studies, antibody production
Polyclonal AntibodyRabbit-derived, affinity purifiedELISA, Western Blot
ELISA KitsDetection of B0310.3 proteinQuantitative protein analysis

These reagents provide researchers with tools to investigate B0310.3 expression, localization, and potential interactions with other cellular components.

Comparative Analysis with Related Proteins

While B0310.3 remains uncharacterized, insights might be gained by examining related proteins. For instance, another uncharacterized protein from the same organism, B0310.1, is also commercially available . Comparative studies between these related proteins might reveal functional parallels or distinctions.

Potential Roles in Gene Regulation

Recent research has highlighted the importance of various proteins in C. elegans gene regulation, including the maintenance of heritable gene silencing through nuclear RNAi pathways . While no direct connection has been established between B0310.3 and these processes, the protein's structural features suggest potential roles in cellular regulation that warrant investigation.

Applications in Protein Assembly Studies

Advanced methodologies such as FRET-based monitoring of protein self-assemblies could potentially be applied to study B0310.3 structural dynamics . Such approaches could reveal whether this protein participates in higher-order assemblies or undergoes conformational changes under specific conditions.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
B0310.3; Uncharacterized protein B0310.3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-445
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
B0310.3
Target Protein Sequence
MPIKCMFPAVNILKFLYTHTPRSFLFILDEKKFSNQMEGNFLNNPWINCCFVTTYAGVVA QYFKKGAEWFNFTTPSIGTFTNEQNEEDSSNYSTSGYDSSAETISANSSPINRSGVRSRI SQKQRQRILKEAHFKAQQLNRKMVVQKSCPPDHEIKPVPSKFYQFDAITDFGFGGPVLLV GMQKDVEVMKLETKEKARSGRKKNRKSKYKCNMYKMTKLAQIVAKIPKKKEVIEIDEDGF QKVSSKKAAKLRTLKPADVPTPPTKVVENKEEVIKLEVIEQPEPIVLPVSTPTVTFSRFE EMKRVVKVEKAQESAKTKALKKSKAISISRHVGFLQILEKLEETEEKPQVENEKKVVVKH VQSARKNQKKGRKNRKVEPPKEEFEPYEEDHYNFKRYFLIIGVYVLVFIYVCTNVLTVGV SYEFPYITLANKSEKNWDSLFSKCV
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_B0310.3

UniGene: Cel.11528

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is protein B0310.3 and what organism does it originate from?

Protein B0310.3 is an uncharacterized protein from the nematode Caenorhabditis elegans with Entrez Gene ID 181923 . It is classified as a hypothetical protein, meaning its existence has been predicted through computational analysis of the C. elegans genome but its function remains largely unknown. The protein is encoded by mRNA sequences NM_075709.3 and NM_075709.5, resulting in protein product NP_508110.3 . C. elegans serves as an important model organism in various fields including genetics, developmental biology, and neurobiology, making this protein potentially significant for understanding fundamental biological processes.

How can I obtain recombinant B0310.3 protein for experimental studies?

Recombinant B0310.3 protein can be obtained through several approaches:

  • Cloning and expression: The cDNA ORF clone for B0310.3 is commercially available from repositories like GenScript in expression vectors such as pcDNA3.1+/C-(K)DYK, which contains a C-terminal DYKDDDDK tag . This clone can be used to express the protein in various systems.

  • Expression systems: Similar to other recombinant proteins, B0310.3 could be expressed in:

    • E. coli systems (for basic studies)

    • Yeast systems (for eukaryotic post-translational modifications)

    • Baculovirus-infected insect cells (for complex eukaryotic proteins)

    • Mammalian cell expression systems (for proteins requiring specific mammalian modifications)

  • Purification approach: Once expressed, the protein can be purified using immobilized metal affinity chromatography (IMAC) with Ni-NTA agarose if expressed with a histidine tag, similar to the methodology used for other recombinant proteins .

What expression vectors are recommended for B0310.3 protein production?

For B0310.3 expression, several vector systems can be considered:

  • pET-28a+ vector: This vector contains a T7 promoter and a histidine tag sequence, allowing for IPTG-inducible expression and affinity purification. Similar to approaches used for other recombinant proteins, this system would allow protein induction with IPTG and subsequent purification under native or denaturing conditions .

  • pcDNA3.1+/C-(K)DYK: This vector, available with the B0310.3 ORF clone, contains a C-terminal DYKDDDDK (FLAG) tag, facilitating detection and purification using anti-FLAG antibodies .

  • Specialized vectors: For enhanced solubility and folding, vectors containing solubility-enhancing tags (e.g., MBP, SUMO, or GST) might be beneficial, especially since uncharacterized proteins often present expression challenges.

The choice of vector should be guided by the intended experimental application and the expression system selected.

What is known about the gene structure and expression pattern of B0310.3 in C. elegans?

While specific information about B0310.3 expression patterns is limited in the provided search results, general insights about C. elegans genes can be applied:

  • 3'UTR characterization: Recent comprehensive analysis of C. elegans 3'UTRs has provided insights into post-transcriptional regulation. The C. elegans 3'UTRome v3 covers 97.4% of experimentally validated protein-coding genes, including elements necessary for pre-mRNA 3'end processing . This resource may contain information about B0310.3's 3'UTR and potential regulatory elements.

  • Gene information: B0310.3 has been identified as part of the C. elegans genome sequencing project, which serves as a platform for investigating nematode biology . The gene produces an uncharacterized protein with currently limited functional annotation.

  • Sequence properties: The complete ORF nucleotide sequence is 1254bp in length . Analysis of this sequence using bioinformatics tools could provide insights into protein domains and potential functions.

What bioinformatic approaches can help predict the function of uncharacterized protein B0310.3?

Several computational approaches can be employed to predict potential functions of B0310.3:

  • Homology-based prediction:

    • Sequence alignment tools (BLAST, HHpred) to identify distant homologs

    • Phylogenetic analysis to determine evolutionary relationships

    • Domain prediction tools (InterPro, Pfam, SMART) to identify conserved domains

  • Structural prediction:

    • AlphaFold2 or RoseTTAFold for ab initio 3D structure prediction

    • Structure comparison with functionally characterized proteins (using DALI or TM-align)

    • Active site prediction based on structural features

  • Network-based inference:

    • Analysis of STRING database associations, which catalogues C. elegans protein interactions (6239.B0303.3.1)

    • Integration with expression data to identify co-expressed genes

    • Metabolic pathway mapping using KEGG resources (cel:CELE_B0303.3)

  • Machine learning approaches:

    • Function prediction based on sequence features, expression patterns, and evolutionary conservation

    • Text mining of scientific literature for potential functional associations

These complementary approaches could collectively provide insights into the potential molecular function, biological process, and cellular localization of B0310.3.

What experimental strategies are recommended for functional characterization of B0310.3?

A comprehensive approach to functionally characterize B0310.3 would include:

  • Gene knockout/knockdown studies:

    • CRISPR-Cas9 mediated gene deletion in C. elegans

    • RNAi-mediated knockdown followed by phenotypic analysis

    • Phenotypic screening across developmental stages and under various stress conditions

  • Protein interaction studies:

    • Yeast two-hybrid screening to identify interacting proteins

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling (BioID or APEX) in vivo to identify proximal proteins

  • Localization studies:

    • GFP tagging and fluorescence microscopy to determine subcellular localization

    • Immunohistochemistry using antibodies against recombinant B0310.3

    • Cell fractionation followed by Western blotting

  • Biochemical characterization:

    • Enzymatic activity assays based on structural predictions

    • Substrate screening if enzymatic function is predicted

    • Binding assays for potential ligands or interaction partners

  • Expression analysis:

    • qRT-PCR to determine expression patterns across tissues and developmental stages

    • RNA-seq to identify conditions affecting gene expression

    • Reporter gene constructs to visualize expression in vivo

These approaches can be prioritized based on bioinformatic predictions and available resources.

How can I optimize expression and purification of recombinant B0310.3 protein for structural studies?

Optimizing B0310.3 expression and purification for structural studies requires careful consideration of several factors:

  • Expression system optimization:

    Expression SystemAdvantagesConsiderations for B0310.3
    E. coliSimple, high yield, cost-effectiveMay lack post-translational modifications
    YeastEukaryotic system, some PTMsModerate yield
    BaculovirusAdvanced eukaryotic PTMsMore complex setup
    Mammalian cellsMost authentic PTMsLower yield, higher cost

    Based on the protein complexity, E. coli might be sufficient for initial characterization , but eukaryotic systems might be necessary if PTMs are critical.

  • Expression condition optimization:

    • Temperature variation (16°C, 25°C, 37°C) during induction

    • IPTG concentration titration (0.1-1.0 mM)

    • Induction time optimization (4-24 hours)

    • Media formulation (standard LB, auto-induction media, minimal media for isotope labeling)

  • Solubility enhancement strategies:

    • Fusion with solubility-enhancing tags (MBP, SUMO, Trx)

    • Co-expression with chaperones

    • Addition of solubilizing agents (low concentrations of urea, arginine)

    • Refolding from inclusion bodies if necessary

  • Purification optimization:

    • Multi-step purification: IMAC followed by ion exchange and size exclusion chromatography

    • Buffer optimization for stability (pH, salt concentration, additives)

    • Removal of fusion tags using specific proteases

    • Assessment of protein homogeneity by dynamic light scattering

  • Quality control for structural studies:

    • Circular dichroism to confirm secondary structure

    • Thermal shift assays to assess stability

    • Limited proteolysis to identify stable domains

    • Mass spectrometry to confirm integrity and modifications

Successful structural studies will require highly pure, homogeneous, and correctly folded protein samples.

What are the challenges in generating specific antibodies against B0310.3 and how can they be overcome?

Generating specific antibodies against uncharacterized proteins like B0310.3 presents several challenges:

  • Antigenicity determination:

    • Bioinformatic prediction of antigenic epitopes

    • Selection of unique regions that differentiate B0310.3 from other C. elegans proteins

    • Consideration of both linear and conformational epitopes

  • Antigen preparation strategies:

    Antigen TypeAdvantagesLimitations
    Full-length proteinComplete epitope representationExpression/purification challenges
    Peptide conjugatesSimple production, targeted epitopesMay miss conformational epitopes
    Domain fragmentsBetter solubility than full-lengthPartial epitope representation
  • Immunization approaches:

    • Multiple host species (rabbit, mouse, chicken) for diverse antibody repertoires

    • Prime-boost strategies with different antigen formulations

    • Adjuvant selection for optimal immune response

  • Antibody purification and validation:

    • Affinity purification against recombinant B0310.3

    • Cross-adsorption against C. elegans lysates from B0310.3 knockout strains

    • Validation using multiple techniques:

      • Western blotting

      • Immunoprecipitation

      • Immunofluorescence

      • Comparison of signals in wild-type vs. knockout/knockdown samples

  • Alternative approaches:

    • Nanobody development for improved accessibility to challenging epitopes

    • Recombinant antibody fragments selected from phage display libraries

    • CRISPR knock-in of epitope tags in C. elegans for detection with commercial antibodies

These comprehensive strategies can help overcome the common challenges in generating specific antibodies against previously uncharacterized proteins.

How can RNA-seq data be utilized to understand the regulation and expression patterns of B0310.3?

RNA-seq data provides valuable insights into the expression and regulation of genes like B0310.3:

  • Expression profiling analysis:

    • Temporal expression patterns across developmental stages

    • Tissue-specific expression profiles

    • Condition-dependent expression (stress, drugs, pathogens)

    • Comparison with known gene clusters to infer function

  • Transcript structure characterization:

    • Identification of alternative transcripts and splice variants

    • Mapping of transcription start sites

    • Characterization of 3'UTR isoforms, which are critical for post-transcriptional regulation in C. elegans

    • Determination of intron-exon boundaries

  • Regulatory network inference:

    • Co-expression analysis to identify genes with similar expression patterns

    • Identification of potential transcription factors through motif analysis

    • Construction of gene regulatory networks

  • Integration with other -omics data:

    • Correlation with proteomics data to assess translation efficiency

    • Integration with ChIP-seq data to identify regulatory elements

    • Combination with metabolomics data to place in metabolic context

  • Comparative analysis:

    • Comparison of expression patterns across nematode species

    • Identification of conserved expression signatures

    • Correlation with phenotypic data from large-scale RNAi screens

The C. elegans research community has generated extensive transcriptomic datasets across various conditions and developmental stages, which can be leveraged to infer the biological context of B0310.3 .

What are the best C. elegans strains and genetic backgrounds for studying B0310.3 function?

Selection of appropriate C. elegans strains is critical for studying B0310.3:

  • Wild-type reference strains:

    • N2 Bristol: Standard laboratory reference strain

    • Other wild isolates to assess natural variation in B0310.3 function

  • Mutant strains for functional studies:

    • B0310.3 deletion/knockout mutants (if available in strain repositories)

    • CRISPR-engineered strains with specific B0310.3 mutations

    • RNAi-sensitive strains (e.g., rrf-3, eri-1) for enhanced knockdown efficiency

  • Reporter strains:

    • Transcriptional reporters (B0310.3 promoter driving GFP)

    • Translational fusion strains (B0310.3::GFP) for protein localization

    • CRISPR knock-in strains with endogenous tagging

  • Sensitized genetic backgrounds:

    • Strains with compromised related pathways (based on bioinformatic predictions)

    • Temperature-sensitive mutants to study genetic interactions

    • Stress-response pathway mutants to assess involvement in stress responses

  • Tissue-specific expression systems:

    • Strains with tissue-specific promoters for rescue experiments

    • Mosaic analysis strains to determine cell autonomy

These strain resources, combined with the wealth of genetic tools available in C. elegans, provide a powerful platform for dissecting B0310.3 function in vivo.

What specialized techniques should be considered for studying potential post-translational modifications of B0310.3?

Investigating post-translational modifications (PTMs) of B0310.3 requires specific techniques:

  • Mass spectrometry-based approaches:

    • Shotgun proteomics to identify PTMs in endogenous B0310.3

    • Selected reaction monitoring for targeted PTM analysis

    • Top-down proteomics for intact protein analysis

    • Enrichment strategies for specific modifications:

      • Phosphorylation: TiO₂ or IMAC enrichment

      • Glycosylation: Lectin affinity or hydrazide chemistry

      • Ubiquitination: K-ε-GG antibody enrichment

  • Site-specific mutation analysis:

    • Systematic mutation of predicted modification sites

    • Phenotypic assessment of mutant proteins

    • In vitro modification assays with purified enzymes

  • PTM-specific detection methods:

    • Western blotting with modification-specific antibodies

    • Phos-tag gels for phosphorylation analysis

    • Glycosylation detection using specialized stains or lectins

    • Proximity ligation assay for in situ detection

  • Enzyme inhibitor studies:

    • Use of specific PTM enzyme inhibitors in vivo

    • Analysis of B0310.3 modification state following inhibition

    • Genetic manipulation of PTM enzymes predicted to target B0310.3

  • Interactome analysis with PTM machinery:

    • Identification of physical interactions with kinases, phosphatases, glycosyltransferases, etc.

    • Validation of interactions through co-immunoprecipitation

    • In vitro reconstitution of modification reactions

These approaches can be prioritized based on bioinformatic predictions of likely modifications and the biological context of B0310.3.

How can CRISPR-Cas9 technology be optimized for studying B0310.3 in C. elegans?

CRISPR-Cas9 technology offers powerful approaches for studying B0310.3 in C. elegans:

  • Guide RNA design considerations:

    • Selection of target sites with minimal off-target effects

    • Consideration of chromatin accessibility at the B0310.3 locus

    • Design of multiple gRNAs to increase editing efficiency

    • Use of proven C. elegans-optimized gRNA scaffolds

  • Gene knockout strategies:

    StrategyAdvantagesConsiderations
    Large deletionComplete loss of functionMay affect neighboring genes
    Frameshift mutationTargeted disruptionPotential for readthrough
    Premature stop codonEarly terminationNonsense-mediated decay evasion
    Conditional knockoutTemporal/spatial controlMore complex design
  • Precise gene editing applications:

    • Introduction of point mutations to study specific residues

    • Insertion of fluorescent protein tags for localization studies

    • Addition of affinity tags for biochemical purification

    • Engineering of degron tags for controlled protein degradation

  • Delivery methods optimization:

    • Microinjection into the gonad with optimal Cas9/gRNA concentrations

    • Co-CRISPR strategies with visible markers for screening

    • Use of purified Cas9-gRNA ribonucleoprotein complexes

    • Selection of appropriate co-injection markers and selection strategies

  • Validation strategies:

    • PCR and sequencing to confirm intended edits

    • Western blotting to confirm protein loss/modification

    • Phenotypic analysis across developmental stages

    • Off-target analysis through whole-genome sequencing

CRISPR-Cas9 approaches provide unprecedented precision for manipulating B0310.3 in its native genomic context.

How should phylogenetic analysis be conducted to understand the evolutionary context of B0310.3?

A comprehensive phylogenetic analysis of B0310.3 should include:

  • Sequence collection strategy:

    • Identification of homologs across nematode species

    • Extension to more distant taxa if homologs exist

    • Inclusion of paralogs within C. elegans

    • Database sources: NCBI, WormBase, UniProt, specialized nematode databases

  • Multiple sequence alignment methodology:

    • Selection of appropriate alignment algorithms (MUSCLE, MAFFT, T-Coffee)

    • Manual curation of alignments to address problematic regions

    • Identification of conserved domains and motifs

    • Refinement using structural information if available

  • Phylogenetic tree construction:

    • Model selection based on alignment characteristics

    • Maximum likelihood methods (RAxML, IQ-TREE)

    • Bayesian inference approaches (MrBayes, BEAST)

    • Evaluation of tree robustness through bootstrap or posterior probabilities

  • Evolutionary analysis:

    • Calculation of substitution rates to identify conserved regions

    • Detection of sites under positive or purifying selection

    • Analysis of gene duplication and loss events

    • Ancestral sequence reconstruction

  • Functional inference:

    • Mapping of functional data from characterized homologs

    • Correlation of sequence conservation with structural features

    • Identification of lineage-specific adaptations

    • Integration with expression data across species

This evolutionary perspective can provide crucial insights into the functional importance and constraints acting on B0310.3.

What statistical approaches are most appropriate for analyzing phenotypic data from B0310.3 mutant studies?

Robust statistical analysis of phenotypic data requires:

  • Experimental design considerations:

    • Power analysis to determine appropriate sample sizes

    • Randomization strategies to minimize bias

    • Inclusion of appropriate positive and negative controls

    • Blinding procedures for subjective measurements

  • Statistical tests for different data types:

    Data TypeAppropriate TestsConsiderations
    Continuous variablest-test, ANOVA, regressionCheck normality assumptions
    Categorical dataChi-square, Fisher's exactAdequate category sizes
    Survival dataLog-rank test, Cox regressionCensoring considerations
    Developmental timingNon-parametric testsAccounting for molting stages
  • Advanced analytical approaches:

    • Mixed-effects models for repeated measures

    • Multivariate analysis for complex phenotypes

    • Machine learning for pattern recognition in complex datasets

    • Bayesian approaches for incorporating prior knowledge

  • Multiple testing correction:

    • False discovery rate control methods (Benjamini-Hochberg)

    • Family-wise error rate control (Bonferroni, Holm-Sidak)

    • Selection of appropriate significance thresholds

  • Visualization strategies:

    • Selection of informative plot types for different data

    • Representation of both raw data and statistical summaries

    • Clear indication of sample sizes and variation

    • Consistent use of error bars (SD, SEM, CI)

How can contradictory results in B0310.3 functional studies be reconciled and interpreted?

Addressing contradictory results requires systematic analysis:

  • Sources of experimental variation:

    • Differences in genetic backgrounds of C. elegans strains

    • Variation in environmental conditions (temperature, food)

    • Methodological differences between laboratories

    • Distinctions between acute and chronic manipulations

  • Reconciliation strategies:

    • Direct replication studies with standardized protocols

    • Meta-analysis of multiple independent studies

    • Identification of context-dependent effects

    • Development of unified models incorporating apparent contradictions

  • Experimental validation approaches:

    • Independent confirmation using complementary techniques

    • Genetic interaction studies to place contradictions in context

    • Tissue-specific or temporal manipulations to resolve spatial/temporal factors

    • Dose-response studies to identify threshold effects

  • Interpretative frameworks:

    • Consideration of pleiotropy and multiple functions

    • Evaluation of genetic compensation mechanisms

    • Assessment of functional redundancy with related proteins

    • Examination of technical limitations in different approaches

  • Collaborative resolution:

    • Direct collaboration between groups with contradictory results

    • Standardization of experimental protocols

    • Exchange of reagents and strains

    • Joint publication of reconciliation studies

Contradictory results often provide valuable insights into complex biological systems and regulatory mechanisms affecting B0310.3 function.

What are the most promising research directions for understanding B0310.3 function in C. elegans biology?

Several promising directions emerge for B0310.3 research:

  • Integrative multi-omics approaches:

    • Combined analysis of transcriptomics, proteomics, and metabolomics data

    • Integration with physical interaction networks

    • Correlation with phenotypic databases

    • Systems biology modeling of potential functional networks

  • Developmental and cell-specific studies:

    • Single-cell RNA-seq to identify cell populations expressing B0310.3

    • Developmental time-course analysis of expression and localization

    • Cell-specific knockout/rescue experiments

    • Lineage-tracing combined with B0310.3 functional analysis

  • Comparative studies across nematode species:

    • Functional conservation analysis in related nematodes

    • Investigation of expression patterns in parasitic vs. free-living species

    • Cross-species rescue experiments

    • Adaptation analysis in different ecological niches

  • Application of emerging technologies:

    • Cryo-EM for structural determination

    • Spatial transcriptomics for localization of expression

    • Optogenetic approaches for temporal control

    • Protein-protein interaction mapping using proximity labeling

  • Integration with human health research:

    • Identification of human homologs, if present

    • Investigation of potential disease relevance

    • Drug screening using C. elegans B0310.3 phenotypes

    • Modeling of human variants in the C. elegans ortholog

These directions collectively offer a comprehensive approach to understanding B0310.3's role in nematode biology and potentially broader biological contexts.

How might characterization of B0310.3 contribute to our understanding of uncharacterized proteins more broadly?

The study of B0310.3 offers broader implications:

  • Methodological advances:

    • Development of integrated workflows for uncharacterized protein studies

    • Refinement of computational prediction approaches

    • Establishment of prioritization strategies for functional testing

    • Creation of reproducible pipelines for moving from sequence to function

  • Biological insights:

    • Discovery of novel protein domains or motifs

    • Identification of previously unknown protein families

    • Elucidation of unexpected cellular processes

    • Understanding of lineage-specific adaptations in nematodes

  • Technological applications:

    • Development of new research tools based on protein properties

    • Identification of biotechnologically useful enzymatic activities

    • Discovery of novel interaction partners with research applications

    • Creation of new genetic tools for C. elegans biology

  • Addressing the "dark proteome":

    • Contribution to reducing the percentage of uncharacterized proteins

    • Establishment of functional classification methods

    • Development of ontologies for newly discovered functions

    • Creation of databases specialized for previously uncharacterized proteins

The systematic characterization of proteins like B0310.3 contributes to filling critical gaps in our understanding of the complete set of protein functions encoded in genomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.