Recombinant Uncharacterized protein C05B5.2 (C05B5.2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and this can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
C05B5.2; Uncharacterized protein C05B5.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-385
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
C05B5.2
Target Protein Sequence
MLNIVLIIGLLAIFNTSSASNDVCHVTRKPLMLPAPGDVYKKAVQFYSNITAPRSTSVLA PVMSSLEVYINTTTTSAFAPAQSIKVADILEEDADAIRVKSIRMAGFIAQCIIFLFVYTI VTMDVEIWKINMDWLKIQYFQHFEDSAAEVPVFKLYMAREIQTCPLPARQNVMILSLIKH IAFIGFQFWLTKPPVARRMTFLKLAIQVLRIPFLFFIAFRAFIIPKFIFLETGSYVATGL FSAFHLTILWIHMNPKSLKSLYYAYIALTVLMLTGWFDFVFRKHCFLKKYGFLVAMGIAG NVPNSREVTMIIELDMLSLTLTLVLLYLQLKKSVAEEFVFPKQPKKSIRGPVCFTNTLTE DNEGYFENIYGDLIFTSRTSNTFSI
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_C05B5.2

UniGene: Cel.10899

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are most suitable for producing recombinant C05B5.2?

For the expression of recombinant C05B5.2, Escherichia coli remains the primary expression platform due to its well-established protocols, rapid growth, and high protein yields. The T7 promoter system in pET vectors (pMB1 ori, medium copy number) is particularly effective, as it can represent up to 50% of the total cell protein in successful cases . The gene encoding C05B5.2 should be cloned behind a promoter recognized by the phage T7 RNA polymerase.

E. coli BL21(DE3) and its derivatives are recommended strains for C05B5.2 expression, as they contain the λDE3 prophage with the T7 RNAP gene under the lacUV5 promoter . For proteins requiring disulfide bond formation, consider AD494 or Origami™ strains (trxB mutants), which enhance disulfide bond formation in the cytoplasm .

When designing your expression system, incorporate control mechanisms to regulate basal expression, including:

  • LacIQ repression of the T7 RNAP gene

  • T7 lysozyme co-expression (via pLysS or pLysE plasmids)

  • Insertion of a lacO operator downstream of the T7 promoter (hybrid T7/lac promoter)

How does the choice of selectable marker affect C05B5.2 expression?

The selectable marker used in your expression vector significantly impacts both expression levels and cell-to-cell variability of C05B5.2. Research with HEK293 cells has demonstrated that different selectable markers establish varying thresholds below which cells cannot survive, directly affecting recombinant protein yields .

When expressing C05B5.2, consider these experimental findings:

Selectable MarkerAntibioticRelative Expression LevelCell-to-Cell Variability
BleoRZeocinHighest (~10x higher than NeoR/BsdR)Lowest
PuroRPuromycinHigh to IntermediateLow to Intermediate
HygRHygromycinHigh to IntermediateLow to Intermediate
NeoRG418LowestHighest
BsdRBlasticidinLowestHighest

For maximum expression of C05B5.2, vectors containing the BleoR marker with zeocin selection are recommended. This combination not only provides the highest expression levels but also minimizes cell-to-cell variability, resulting in more consistent experimental outcomes .

What are the key variables to consider in experimental design for C05B5.2 characterization?

When designing experiments to characterize C05B5.2, clearly identify your independent and dependent variables. Start with a specific research question such as "How does temperature affect the solubility of C05B5.2?" or "What buffer conditions optimize C05B5.2 stability?" .

For each experiment, systematically define:

  • Independent variable(s): The condition you are manipulating (e.g., temperature, pH, salt concentration)

  • Dependent variable(s): The outcome you are measuring (e.g., protein yield, enzymatic activity, stability)

  • Extraneous variables: Other factors that might influence your results

Control extraneous variables through experimental design techniques such as:

  • Randomization

  • Blocking

  • Use of appropriate controls

  • Standardized measurement procedures

What methodology should I include in publications about C05B5.2?

When reporting your research on C05B5.2, the methodology section must thoroughly describe how data was collected and analyzed. The writing should be direct, precise, and always in past tense . Your methodology should address:

  • How C05B5.2 was expressed and purified

  • What analytical techniques were employed

  • How measurements were standardized

  • What statistical analyses were performed

Include sufficient detail to allow other researchers to replicate your work. Explain not only what methods you used but also why you selected those particular approaches . When reporting protein expression methods, specify:

  • Expression vector and its key features

  • Host strain characteristics

  • Culture conditions (media, temperature, induction method)

  • Cell lysis procedure

  • Purification strategy with buffer compositions

  • Verification methods for protein identity and purity

What strategies can optimize solubility and stability of C05B5.2 during expression?

Enhancing the solubility and stability of C05B5.2 requires systematically testing multiple expression parameters. Based on established protocols for challenging recombinant proteins, implement the following strategies:

  • Temperature optimization: Lower induction temperatures (15-25°C) often improve folding and reduce inclusion body formation .

  • Induction adjustments: Test varying IPTG concentrations (0.1-1.0 mM) and induction times to find the optimal balance between expression level and solubility .

  • Co-expression with chaperones: Consider co-expressing C05B5.2 with folding chaperones such as GroEL/GroES, DnaK/DnaJ/GrpE, or trigger factor to assist proper folding .

  • Fusion tags selection: Experiment with solubility-enhancing fusion partners:

Fusion TagSize (kDa)AdvantagesPotential Impact on C05B5.2
MBP (Maltose Binding Protein)42Highly soluble, affinity purificationSignificant solubility enhancement
GST (Glutathione S-Transferase)26Affinity purification, dimerizationModerate solubility improvement
SUMO11Native N-terminus after cleavageImproved folding and stability
Thioredoxin12Disulfide enhancementStabilizes disulfide-containing domains
NusA55Highly solubleExcellent solubility enhancement but large size
  • Buffer optimization: Systematically screen buffer conditions during lysis and purification, testing variations in pH (6.0-8.5), salt concentration (100-500 mM NaCl), and stabilizing additives (10% glycerol, 1-5 mM DTT, 0.05-0.1% detergents for membrane-associated forms) .

How can I resolve contradictory data about C05B5.2 function from different experimental approaches?

When faced with conflicting results about C05B5.2 function from different methodological approaches, implement a systematic reconciliation strategy:

  • Methodological analysis: Critically evaluate the experimental design of each study. Different methods may measure different aspects of protein function or have distinct limitations .

  • Condition comparison: Create a comprehensive table comparing experimental conditions across studies:

ParameterStudy 1Study 2Study 3Potential Impact on Results
Expression systemE. coli BL21(DE3)HEK293YeastPost-translational modifications
Purification methodIMACGST-tagIon exchangeStructural differences, contaminants
Buffer compositionpH 7.4, 150 mM NaClpH 6.8, 500 mM NaClpH 8.0, 100 mM NaClActivity, stability, binding properties
Assay temperature25°C37°C4°CEnzymatic rate, binding kinetics
Protein concentration10 μM100 nM1 mMAggregation, complex formation
  • Orthogonal validation: Design experiments that test C05B5.2 function using multiple independent techniques (e.g., enzymatic assays, binding studies, structural analyses, cellular assays) .

  • Physiological relevance assessment: Evaluate which experimental conditions most closely resemble the natural environment of C05B5.2 .

  • Context dependency framework: Consider that C05B5.2 may have context-dependent functions that vary with cellular conditions or interaction partners .

What approaches are most effective for identifying potential interaction partners of C05B5.2?

To comprehensively identify and validate interaction partners of the uncharacterized protein C05B5.2, employ a multi-faceted approach:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express C05B5.2 with an affinity tag (e.g., His, FLAG, or Strep-tag II)

    • Perform pull-downs under varying stringency conditions

    • Analyze co-purifying proteins by mass spectrometry

    • Implement appropriate controls (e.g., tag-only, unrelated protein)

  • Proximity labeling:

    • Generate fusion proteins of C05B5.2 with BioID or APEX2

    • Express in relevant cell types and induce biotinylation

    • Purify biotinylated proteins and identify by mass spectrometry

    • This approach can capture transient interactions and is suitable for membrane-proximal proteins

  • Yeast two-hybrid screening:

    • Create bait constructs with C05B5.2 (full-length and domains)

    • Screen against prey libraries from tissues of interest

    • Validate hits with targeted Y2H assays

    • Note limitations regarding membrane proteins and post-translational modifications

  • Computational predictions:

    • Employ machine learning algorithms to predict functional associations

    • Use structural modeling to identify potential binding interfaces

    • Cross-reference with co-expression data from transcriptomic databases

  • Validation experiments:

    • Co-immunoprecipitation in relevant cell types

    • Bimolecular fluorescence complementation (BiFC)

    • Fluorescence resonance energy transfer (FRET)

    • Functional assays to test biological relevance of interactions

How should I design controlled experiments to determine C05B5.2 subcellular localization?

Determining the subcellular localization of C05B5.2 requires careful experimental design with appropriate controls to ensure reliable results:

  • Fluorescent protein fusion approach:

    • Create both N- and C-terminal fusion constructs (GFP/mCherry/mScarlet-C05B5.2 and C05B5.2-GFP/mCherry/mScarlet)

    • Use a flexible linker (e.g., GGGGS) between C05B5.2 and the fluorescent protein

    • Express at near-endogenous levels to avoid localization artifacts

    • Co-stain with established organelle markers

  • Immunofluorescence with antibodies:

    • Generate or obtain antibodies against C05B5.2

    • Validate antibody specificity (western blot, knockout controls)

    • Fix cells using multiple methods (PFA, methanol) as fixation can affect epitope accessibility

    • Use both permeabilization protocols (Triton X-100, saponin) to access different cellular compartments

  • Subcellular fractionation:

    • Separate cellular components by differential centrifugation

    • Analyze fractions by western blotting for C05B5.2

    • Include markers for each cellular compartment (e.g., Na+/K+-ATPase for plasma membrane, GAPDH for cytosol)

  • Live-cell imaging considerations:

    • Monitor potential dynamic changes in localization

    • Investigate responses to stimuli or stress conditions

    • Track temporal patterns (cell cycle dependency, circadian changes)

  • Controls and validation:

    • Include proteins with known localization patterns

    • Compare results across multiple cell types

    • Verify that tags do not disrupt targeting sequences or protein folding

    • Confirm findings with orthogonal methods

How can I address poor expression yields of C05B5.2?

When encountering low expression yields of C05B5.2, implement a systematic troubleshooting approach:

  • Codon optimization analysis:

    • Check for rare codons in the C05B5.2 sequence

    • Consider synthesizing a codon-optimized gene for your expression host

    • Alternatively, use specialized strains containing additional tRNA genes (e.g., Rosetta)

  • Expression strain evaluation:

    • Test multiple E. coli strains beyond BL21(DE3)

    • Consider specialized strains like Arctic Express (for low-temperature expression) or Origami (for disulfide bond formation)

    • For particularly challenging cases, explore alternative expression hosts (mammalian cells, insect cells)

  • Systematic optimization matrix:

ParameterTest RangeMeasurement Method
IPTG concentration0.1, 0.5, 1.0 mMSDS-PAGE, western blot
Temperature15, 25, 37°CSolubility analysis
Media compositionLB, TB, 2xYT, auto-inductionTotal protein yield
Induction OD₆₀₀0.4, 0.8, 1.2Expression level
Expression time3h, 6h, overnightTime-course analysis
  • Toxicity assessment:

    • Monitor growth curves with and without induction

    • If C05B5.2 is toxic, switch to tightly controlled expression systems

    • Consider using C41(DE3) or C43(DE3) strains designed for toxic proteins

  • Vector redesign strategies:

    • Test different selectable markers (BleoR shows highest expression)

    • Explore periplasmic targeting to reduce cytoplasmic toxicity

    • Add stabilizing fusion partners (MBP, GST, SUMO)

What methods can accurately assess the structural integrity of purified C05B5.2?

Evaluating the structural integrity of purified C05B5.2 is essential to ensure that functional studies are conducted with properly folded protein. Implement these complementary approaches:

  • Biophysical characterization techniques:

MethodInformation ProvidedSample RequirementsAdvantages for C05B5.2 Analysis
Circular Dichroism (CD)Secondary structure content0.1-1 mg/ml, 200-300 μlRapid assessment of folding state
Differential Scanning Fluorimetry (DSF)Thermal stability, buffer optimization1-5 μM, 20 μlHigh-throughput buffer screening
Size Exclusion Chromatography (SEC)Oligomeric state, aggregation0.5-5 mg/ml, 100 μlSeparation of different species
Dynamic Light Scattering (DLS)Hydrodynamic radius, polydispersity0.5-2 mg/ml, 100 μlDetection of aggregation
Limited proteolysisDomain boundaries, flexible regions0.5-1 mg/ml, 100 μlProbing protein foldedness
  • Functional validation:

    • Activity assays (if function is known or predicted)

    • Binding assays with known ligands or interaction partners

    • Comparative analysis with homologous proteins of known function

  • Structural analysis workflow:

    • Begin with SEC-MALS to determine absolute molecular weight and oligomeric state

    • Perform CD to assess secondary structure content

    • Use DSF to optimize buffer conditions that maximize stability

    • For detailed structural characterization, consider NMR or X-ray crystallography if resources permit

  • Stability monitoring:

    • Track stability over time under various storage conditions

    • Document behavior through freeze-thaw cycles

    • Assess batch-to-batch variability using consistent analytical methods

How should I analyze and present dose-response data for C05B5.2 activity?

When analyzing dose-response relationships for C05B5.2 activity, employ rigorous statistical approaches and clear data presentation:

  • Experimental design considerations:

    • Use a wide concentration range (spanning at least 3-4 orders of magnitude)

    • Include sufficient data points (minimum 8-10 concentrations)

    • Perform experiments in triplicate (technical replicates)

    • Repeat entire experiments at least three times (biological replicates)

  • Data analysis workflow:

    • Plot raw data points for all replicates

    • Fit appropriate models (typically four-parameter logistic regression)

    • Calculate EC₅₀/IC₅₀ values with 95% confidence intervals

    • Assess goodness of fit (R², residual plots)

  • Statistical considerations:

    • Test for normality of residuals

    • Use appropriate transformations if needed (log-transformation common for concentration values)

    • Apply statistical tests to compare multiple dose-response curves

    • Report both statistical and practical significance

  • Presentation guidelines:

    • Use semi-logarithmic plots (log scale for concentration, linear scale for response)

    • Include both individual data points and fitted curves

    • Present error bars (standard deviation or standard error of mean)

    • Clearly state the model used and goodness-of-fit statistics

  • Example data table format:

CompoundEC₅₀ (μM)95% CIHill SlopeEfficacy (%)n
Ligand 10.420.35-0.511.21004
Ligand 22.181.85-2.560.8854
Ligand 3>50--<304

What statistical approaches are most appropriate for analyzing variability in C05B5.2 expression?

When analyzing variability in C05B5.2 expression across different experimental conditions, employ statistical approaches that account for both technical and biological sources of variation:

  • Variance component analysis:

    • Distinguish between biological variability and technical noise

    • Implement mixed-effects models to quantify sources of variation

    • Use nested experimental designs to isolate variability at different levels

  • Statistical testing framework:

    • For normally distributed data: ANOVA followed by appropriate post-hoc tests

    • For non-normally distributed data: Non-parametric alternatives (Kruskal-Wallis, Mann-Whitney)

    • For complex designs: Mixed-effects models with appropriate error structures

  • Expression variability metrics:

    • Coefficient of variation (CV%) for comparing variability across conditions

    • Quantile-based measures (IQR/median) for skewed distributions

    • Cell-to-cell variability indices for single-cell analyses

  • Visualization strategies:

    • Box plots with individual data points

    • Violin plots to show distribution shapes

    • Radar plots for multidimensional comparisons

    • Heat maps for correlation patterns

  • Reproducibility assessment:

    • Calculate intraclass correlation coefficients between replicates

    • Perform power analyses to determine appropriate sample sizes

    • Implement Bland-Altman plots for method comparisons

Research has shown that the choice of selectable marker significantly impacts expression variability, with BleoR (zeocin selection) providing the most consistent C05B5.2 expression levels and lowest cell-to-cell variability compared to NeoR or BsdR markers, which exhibit the highest variability .

What emerging technologies could advance characterization of C05B5.2?

Several cutting-edge technologies show promise for deeper characterization of uncharacterized proteins like C05B5.2:

  • Cryo-electron microscopy (Cryo-EM):

    • Enables structural determination without crystallization

    • Particularly valuable for membrane-associated proteins

    • Can resolve different conformational states

    • Provides insights into protein complexes

  • Advanced protein engineering approaches:

    • Deep mutational scanning to map functional residues

    • Directed evolution to enhance stability or expression

    • Synthetic protein design to predict function

    • Split protein complementation for interaction studies

  • Single-molecule techniques:

    • FRET-based conformational analyses

    • Force spectroscopy to measure mechanical properties

    • Single-molecule tracking in live cells

    • These approaches overcome limitations of bulk measurements

  • Computational prediction tools:

    • Machine learning algorithms for function prediction

    • Molecular dynamics simulations for conformational sampling

    • Integrative modeling combining multiple data types

    • Protein-protein interaction network analyses

  • High-throughput phenotypic screens:

    • CRISPR-based functional genomics

    • Cell painting and image-based profiling

    • Chemogenomic profiling

    • These methods can link C05B5.2 to specific cellular pathways

How can contradictions in published C05B5.2 function be resolved through integrated approaches?

Resolving contradictory findings about C05B5.2 function requires an integrated research strategy that combines multiple lines of evidence:

  • Meta-analysis framework:

    • Systematically review all published data on C05B5.2

    • Standardize results across different experimental platforms

    • Identify patterns in contradictions (e.g., cell-type specific effects)

    • Perform statistical assessment of result reproducibility

  • Orthogonal validation pipeline:

    • Design experiments that test function through independent methodologies

    • Compare in vitro biochemical assays with cellular and in vivo approaches

    • Implement genetic approaches (knockout, knockdown, overexpression)

    • Validate with both gain-of-function and loss-of-function studies

  • Structure-function relationship mapping:

    • Generate domain truncations and point mutations

    • Correlate structural features with functional outcomes

    • Use cross-linking mass spectrometry to identify interaction surfaces

    • Employ HDX-MS to map conformational changes upon activation

  • Systems biology integration:

    • Place C05B5.2 in broader pathway contexts

    • Analyze effects of C05B5.2 perturbation on global cellular processes

    • Use network analysis to predict function based on interaction partners

    • Implement multi-omics approaches (proteomics, transcriptomics, metabolomics)

  • Collaborative validation:

    • Establish multi-laboratory validation studies

    • Implement standardized protocols across research groups

    • Share reagents and analytical tools

    • This approach minimizes lab-specific effects influencing results

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.