Recombinant Uncharacterized protein C05B5.8 (C05B5.8)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on shipping method and destination. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. To prioritize a specific tag, please indicate your preference at the time of ordering.
Tag type is determined during production. To prioritize a specific tag, please indicate your preference at the time of ordering.
Synonyms
C05B5.8; Uncharacterized protein C05B5.8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
C05B5.8
Target Protein Sequence
MSTQIPMDPPKFLCMPARPLVVGLAVFGAIRSFVQFWMSSGFGMAGTHFCVLLLDLLLLF
GAYKNDVFALKWSQRVTFACVLIAIIRFMIYPVVFASYMASGLSRNFTGIDSEEIEILGN
VTTPEQNFVFGMISGFTLEFATALSIGVESLKYLLVHRLWEYAKATEASSSSRYVIP
Uniprot No.
Target Background
Database Links
KEGG: cel:CELE_C05B5.8
UniGene: Cel.10895
Subcellular Location
Membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
