Recombinant Uncharacterized protein C07A9.12 (C07A9.12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
C07A9.12; Uncharacterized protein C07A9.12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
C07A9.12
Target Protein Sequence
MIYVSSDSFFVFWRPGSNQNILTFYRAMKLWSTWITLLILTFFCSECNAKRGGRGGGGSS AMGKHYSRSKSYFTRKYSKPGSIEHTSSFRSFVFGATSGLLMFNAGRHIIQDSSEPISFG NRKYFWGESKYVPDEELPVQCINKIDPQDPQFGKVFFDNESRPQEIVYACPADNNCCGYD CCSNSTIFTSIFSLLVILLIVSVLSIFVIECVRWCLHCTYFCKHGHGRDFEPLSI
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_C07A9.12

UniGene: Cel.37094

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is C07A9.12 and what do we currently know about this protein?

    C07A9.12 is an uncharacterized protein in Caenorhabditis elegans that has been identified in genomic studies but lacks functional annotation. Based on available data, it appears in studies of genetic modifiers and may be categorized under membrane-related functions (EM classification) . Like many uncharacterized proteins, it represents an opportunity to discover novel biological functions through systematic experimental characterization. Current research suggests it may have properties similar to other membrane proteins, though its specific role remains to be elucidated through targeted studies.

  • What expression systems are most effective for recombinant C07A9.12 production?

    Multiple expression systems can be employed for recombinant C07A9.12 production, with E. coli being the most commonly used for initial characterization due to its simplicity and cost-effectiveness. Based on recombinant protein studies, the following systems have distinct advantages:

    Expression SystemAdvantagesConsiderations for C07A9.12
    E. coli (BL21(DE3), Rosetta-GAMI)Rapid growth, high yield, cost-effectiveMay require optimization for membrane proteins
    Yeast (SMD1168, GS115, X-33)Better folding for eukaryotic proteinsLonger production time but improved solubility
    Insect cells (Sf9, Sf21, High Five)Superior post-translational modificationsMore complex but potentially more native-like structure
    Mammalian (293T, CHO)Most native-like processingHighest cost, lowest yield, but potentially highest quality

    For uncharacterized proteins like C07A9.12, it's often beneficial to test multiple expression systems in parallel to determine optimal conditions for soluble, functional protein production .

  • What fusion tags are recommended for purification and solubility enhancement of C07A9.12?

    For uncharacterized proteins like C07A9.12, fusion tags serve dual purposes of improving solubility and facilitating purification. Based on recombinant protein methodologies, the following tags are recommended:

    • His-tag: Allows for efficient purification using metal affinity chromatography; can be placed at either N- or C-terminus depending on predicted structure .

    • SUMO tag: Significantly enhances solubility while maintaining native protein structure; studies with other recombinant proteins show SUMO fusion can increase solubility by preserving proper folding .

    • MBP (Maltose Binding Protein): Highly effective for enhancing solubility of challenging proteins; larger than His-tag but offers robust solubility benefits .

    • GST (Glutathione S-Transferase): Useful for both purification and solubility enhancement; enables single-step purification via glutathione affinity .

    Experimental approaches should include testing multiple tag configurations, as the optimal tag may vary depending on the specific properties of C07A9.12. Consider including a precision protease cleavage site to remove the tag after purification if native protein is required for functional studies.

  • How can I verify the expression and identity of recombinant C07A9.12?

    Verification of recombinant C07A9.12 expression and identity should employ multiple complementary methods:

    1. SDS-PAGE and Western Blot: Visualize protein size and expression level; use antibodies against the fusion tag for detection if specific antibodies to C07A9.12 are unavailable .

    2. Mass Spectrometry: Confirm protein identity through peptide mass fingerprinting; endoproteinases like Asp-N and Glu-C can generate unique peptide fragments for MS analysis .

    3. Protease Digestion Patterns: Using specific endoproteinases such as Asp-N (which cleaves at the N-terminus of aspartic and cysteic acid) and Glu-C (which cleaves at the C-terminus of glutamic and aspartic acids) can create characteristic peptide patterns for identification .

    4. Indirect ELISA: If antibodies are available or if using tagged protein, ELISA can quantitatively assess expression levels with high sensitivity .

    Experimental validation should include controls such as empty vector and known expressible proteins to ensure that observed results are specific to C07A9.12.

Advanced Research Methodology

  • What experimental designs are most appropriate for functional characterization of uncharacterized proteins like C07A9.12?

    Functional characterization of uncharacterized proteins requires a systematic experimental approach:

    1. True Experimental Designs: Implement randomized controlled trials with clearly defined independent variables (treatments) and dependent variables (outcomes) . For C07A9.12, this might involve:

      • Treatment groups expressing wild-type vs. mutant C07A9.12

      • Control groups with empty vectors or known proteins

      • Random assignment to eliminate confounding variables

    2. Time-Series Experiments: Track changes in phenotype or molecular interactions over time following induction or repression of C07A9.12 .

    3. Equivalent Materials Design: Test function across different genetic backgrounds or conditions while keeping C07A9.12 expression constant .

    4. Multiple Time-Series Design: Compare C07A9.12 function across different genetic backgrounds or conditions over time .

    The choice of design should be guided by preliminary data and hypotheses about C07A9.12 function. Statistical power analysis should be conducted to determine appropriate sample sizes before beginning experiments.

  • How can I design an shRNA library screen to identify potential regulatory roles of C07A9.12?

    Based on successful shRNA screening approaches used to identify novel protein functions, the following methodology is recommended for C07A9.12:

    1. Library Design: Create a comprehensive shRNA library targeting >20,000 genes, similar to the approach that identified SANBR (SANT and BTB domain regulator of CSR) .

    2. Cell System Selection: Choose an appropriate cell system where C07A9.12 is expressed; for C. elegans proteins, consider using cell lines derived from the organism or heterologous systems with relevant pathways.

    3. Phenotypic Readout: Establish a clear, quantifiable phenotype associated with C07A9.12 function or its pathway. This could be based on:

      • Gene expression changes

      • Protein localization

      • Cell morphology

      • Specific cellular processes

    4. Screening Protocol:

      • Transfect cells with the shRNA library

      • Select for cells showing altered phenotypes

      • Recover shRNAs from selected cells

      • Sequence to identify target genes

      • Validate hits with individual shRNAs

    5. Data Analysis: Use statistical methods to identify significant hits, typically employing:

      • Z-score normalization

      • False discovery rate control

      • Pathway enrichment analysis

    This approach has successfully identified functions for previously uncharacterized proteins like SANBR and could be adapted for C07A9.12 .

  • What proteomic approaches can identify interaction partners of C07A9.12?

    To identify interaction partners of uncharacterized proteins like C07A9.12, several complementary proteomic approaches should be employed:

    1. Affinity Purification-Mass Spectrometry (AP-MS):

      • Express tagged C07A9.12 in an appropriate system

      • Perform pull-down experiments using the tag

      • Identify co-purifying proteins by LC-MS/MS

      • Compare to control pull-downs to eliminate false positives

    2. Proximity-Dependent Biotin Identification (BioID):

      • Fuse C07A9.12 to a biotin ligase

      • Allow in vivo biotinylation of proximal proteins

      • Purify biotinylated proteins and identify by MS

    3. Comprehensive Genomic Context Inferences:

      • Similar to approaches used in E. coli functional atlasing

      • Generate probabilistic functional association networks

      • Identify putative physical interactions (>5,000) and functional associations (>70,000)

    4. Ubiquitin-Modified Proteome Analysis:

      • If C07A9.12 is involved in protein degradation pathways

      • Use methods similar to the ubiquitin-modified proteome characterization in CHO cells

      • Employ quantitative label-free LC-MS/MS after ubiquitinated peptide enrichment

    These approaches have successfully identified interaction networks for previously uncharacterized proteins, leading to functional insights.

  • How can I optimize expression conditions for maximum yield of soluble C07A9.12?

    Optimization of expression conditions for uncharacterized proteins requires systematic testing of multiple parameters:

    1. Expression Parameter Matrix:

      ParameterVariables to TestMonitoring Method
      Induction temperature16°C, 25°C, 30°C, 37°CSDS-PAGE of soluble fraction
      Inducer concentration0.1-1.0 mM IPTG for E. coliWestern blot quantification
      Media compositionLB, TB, autoinductionYield measurement
      Cell density at inductionOD600 of 0.4-1.0Growth curve analysis
      Expression duration3h, 6h, overnight, 24hTime-course sampling
      AdditivesGlycerol, sorbitol, ethanolSolubility comparison
    2. Chaperone Co-expression:

      • Test co-expression with molecular chaperones like DnaK

      • DnaK can increase solubility approximately 3-fold for difficult proteins

      • Design with proper controls to measure fold-improvement

    3. Solubility Enhancement:

      • For membrane proteins like C07A9.12 might be, test detergents

      • Include fusion tags known to enhance solubility (SUMO, MBP)

      • Evaluate using both SDS-PAGE and activity assays

    4. Proteolytic Assessment:

      • Use Lon-based proteolytic assay to assess structural content

      • Determine if protein has intrinsically disordered regions

      • Quantify degraded vs. undegraded fractions as indicators of structure

    Systematic testing using this approach has been shown to successfully optimize expression of challenging proteins, including those with minimal structural information available.

Special Topics in Recombinant Protein Research

  • What are the best approaches for studying potential post-translational modifications of C07A9.12?

    To comprehensively study post-translational modifications (PTMs) of an uncharacterized protein like C07A9.12, implement this methodological framework:

    1. Prediction and Initial Assessment:

      • Use bioinformatic tools to predict potential PTM sites

      • Design expression systems that maintain relevant modifications

      • Consider using eukaryotic expression systems (yeast, insect, or mammalian) that better preserve PTMs compared to E. coli

    2. Site-Specific Mutational Analysis:

      • Create point mutations at predicted PTM sites

      • Compare mutant vs. wild-type protein for functional differences

      • Use phosphomimetic mutations (e.g., S→D) to simulate phosphorylation

    3. MS-Based PTM Analysis:

      • Implement enrichment strategies for specific PTM types:

        PTM TypeEnrichment MethodDetection Approach
        PhosphorylationIMAC, titanium dioxideNeutral loss scanning
        GlycosylationLectin affinity, hydrazide chemistryGlycopeptide fragmentation
        UbiquitinationK-ε-GG antibody enrichmentRemnant modification detection
        AcetylationAnti-acetyllysine antibodiesDiagnostic fragments
      • Use both bottom-up and top-down proteomics for comprehensive coverage

    4. PTM Dynamics Studies:

      • Monitor changes in PTMs under different conditions

      • Use pulse-chase labeling to track modification turnover

      • Employ quantitative approaches like SILAC or TMT labeling

    5. Functional Impact Assessment:

      • Compare function of modified vs. unmodified protein

      • Test effect of modification-site mutations on protein-protein interactions

      • Analyze impact on localization, stability, and activity

    This systematic approach has proven effective for characterizing PTMs on previously uncharacterized proteins and relating them to protein function.

  • How can I design experiments to determine the subcellular localization of C07A9.12?

    Determining subcellular localization of uncharacterized proteins requires a multi-technique approach:

    1. Fluorescent Protein Fusion Constructs:

      • Generate N- and C-terminal GFP (or other fluorescent protein) fusions

      • Express in relevant cell types (consider C. elegans cells for C07A9.12)

      • Use confocal microscopy to visualize localization

      • Co-stain with established organelle markers

    2. Biochemical Fractionation:

      • Perform sequential cellular fractionation to isolate:

        • Cytosolic fraction

        • Membrane fraction

        • Nuclear fraction

        • Organelle-specific fractions

      • Detect protein in fractions via Western blot

      • Compare to known markers of each compartment

    3. Immunofluorescence Microscopy:

      • If antibodies are available or can be generated

      • Validate antibody specificity (especially important for uncharacterized proteins)

      • Perform co-localization studies with organelle markers

    4. Proximity Labeling Methods:

      • Fuse C07A9.12 to BioID or APEX2

      • Allow in vivo biotinylation of proximal proteins

      • Identify these proteins by MS to infer location

      • Compare to databases of organelle-specific proteins

    5. Electron Microscopy:

      • For high-resolution localization

      • Use immunogold labeling if antibodies are available

      • Can reveal association with specific substructures

    Combining these approaches provides robust evidence for subcellular localization and can suggest potential functions based on the compartments where C07A9.12 is found. This strategy has been successfully used to characterize numerous previously uncharacterized proteins.

  • What are the best practices for reporting research on uncharacterized proteins?

    When reporting research on uncharacterized proteins like C07A9.12, adhere to these methodological best practices:

    1. Complete Experimental Design Reporting:

      • Describe all variables manipulated (independent variables)

      • Detail all outcomes measured (dependent variables)

      • Report randomization procedures

      • Explain how sample sizes were determined

    2. Comprehensive Methods Documentation:

      • Provide complete sequences used, including all tags and linkers

      • Detail expression conditions with precision (temperatures, induction parameters)

      • Describe purification protocols with buffer compositions

      • Report all software and databases used for analysis with versions

    3. Transparent Results Presentation:

      • Include all relevant controls in figures

      • Show representative images of gels, blots, and micrographs

      • Present quantitative data with appropriate statistical measures

      • Include negative or contradictory results

    4. Contextual Interpretation:

      • Discuss findings in relation to available information on the protein

      • Compare to similar proteins if structural or sequence similarities exist

      • Present multiple possible interpretations of ambiguous results

      • Clearly distinguish between data and speculation

    5. Data Availability:

      • Deposit raw MS data in public repositories

      • Share plasmids through repositories like Addgene

      • Provide computational code used for analysis

      • Consider making detailed protocols available via protocols.io

    Following these practices ensures that research on uncharacterized proteins contributes maximally to scientific knowledge and facilitates follow-up studies by other researchers. This approach has been essential for building our understanding of previously uncharacterized proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.