Recombinant Uncharacterized protein C07A9.8 (C07A9.8)

Shipped with Ice Packs
In Stock

Description

Definition and Nomenclature

Recombinant Uncharacterized protein C07A9.8 (C07A9.8), also known as best-5, is a multi-pass membrane protein encoded by the C07A9.8 locus in Caenorhabditis elegans. It belongs to the bestrophin family, a group of ion channels and transporters implicated in cellular processes such as calcium signaling and chloride transport . Despite its conserved sequence, its precise biological function remains uncharacterized.

Physical and Biochemical Properties

  • Subcellular Localization: Predicted to localize to the membrane as a multi-pass protein .

  • Function: While no direct functional data are available, sequence similarity to bestrophin family members suggests potential roles in ion transport or cellular signaling .

  • Applications: Primarily used in biochemical assays (e.g., SDS-PAGE) and structural studies .

Research Context and Functional Insights

While C07A9.8 lacks direct functional characterization, C. elegans RNAi studies provide a framework for studying uncharacterized genes:

  • RNAi Phenotyping: RNA interference (RNAi) is a validated method in C. elegans to link genes to phenotypes (e.g., sterility, uncoordinated movement) .

  • Proteomic Approaches: Tandem affinity purification (TAP) and mass spectrometry, as used for spliceosome-related proteins in C. elegans, could identify C07A9.8 interactors .

Comparative Analysis of Recombinant Sources

SourceHostTagPurityApplications
Creative BioMart E. coliHis (N-term)>90%SDS-PAGE, structural studies
THE BioTekYeastN/A>85%Biochemical assays

Future Research Directions

  • Functional Studies: RNAi knockdown in C. elegans to screen for developmental or behavioral phenotypes .

  • Proteomic Interactions: Co-IP or TAP to identify binding partners (e.g., spliceosomal proteins, ion channels) .

  • Structural Analysis: X-ray crystallography or cryo-EM to elucidate conformational dynamics.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format preferences, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery estimates, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional charges may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag based on your preference.
Synonyms
best-5; C07A9.8; Bestrophin homolog 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-453
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
best-5
Target Protein Sequence
MTNNNDPKCVVIEEPDDVPVKPPKIFDFTDWPFEIPDIFKRKELSYNYNYDLATSKSLMI VRMIFKWRGSLWQAVYKELIVWICAYSLVSVIYRFALTRSQKDIFERFGEYCDARMGYLP LNFVLGFFCNIIIRRWLKLYTSLGNIDNIALFVSAYVRGTDDRARQIRRNIIRYCVISQC LVFRDIHVGVRRRFPTLEAVAQAGIMLPHELEKFNSIKSRYQKYWVSFNWALELLNVAKT EKSIDGDNARNAIAQEISKFRSALTTVSMYDWVPIPLMYPQLVNMAVHTYFFLCIFTRQF FISADAHNKTEVDLYIPFMTIIEFIFYMGWLKVAMELLNPFGEDADDFDCNLLIDRNLAI GLTSVDDAYDQLPEVKPDVFTGGSVKPLDSDDTRSLKYHFGSAAQMEEISYLKKEENKMI AAGKKPNKLKLWVKSVRRKRFETSATQPSFPIP
Uniprot No.

Target Background

Function
This protein forms chloride channels.
Database Links

KEGG: cel:CELE_C07A9.8

STRING: 6239.C07A9.8

UniGene: Cel.10863

Protein Families
Bestrophin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is protein C07A9.8 and where is it expressed in C. elegans?

C07A9.8 is classified as a putative membrane protein in C. elegans with designation 2.1.III according to genomic clustering studies . While specific expression patterns are not fully characterized, researchers typically determine this through:

  • RNA-seq analysis across developmental stages

  • Tissue-specific transcriptomics

  • Reporter gene fusion constructs (GFP/mCherry)

  • In situ hybridization techniques

Expression analysis should include biological triplicates as standard experimental design, similar to approaches used for other C. elegans genes studied in infection response models .

What structural domains have been identified in C07A9.8?

As an uncharacterized protein, complete domain architecture for C07A9.8 is not fully established. Researchers should employ multiple complementary approaches:

Computational Analysis ToolsPurposeOutput
InterProScanDomain predictionConserved domains, protein families
TMHMMTransmembrane predictionNumber and position of transmembrane helices
SignalPSignal peptide predictionPresence/absence of signal peptides
PhobiusCombined analysisMembrane topology
I-TASSER3D structure predictionStructural models

Similar approaches have been successful for characterization of other hypothetical proteins in microbial studies where proteins have been analyzed for "subcellular localization, secretory nature and physicochemical properties" .

How can biological replicates improve the reliability of functional studies on C07A9.8?

Robust experimental design for C07A9.8 characterization should include:

  • Minimum of three biological replicates for all expression analyses

  • Technical triplicates for each biological sample

  • Appropriate statistical validation using Student's t-test and ANOVA

  • Significance threshold typically set at p < 0.05

This approach aligns with established protocols where "the entire experiment was performed three times" to ensure statistical validity . For expression studies specifically, researchers should ensure expression is measured "on average more than twofold in at least two of three of the replicates" to be considered significant .

What approaches are most effective for functional characterization of putative membrane proteins like C07A9.8?

For membrane proteins like C07A9.8, a multi-faceted approach is recommended:

  • RNAi knockdown studies: Feeding or injection protocols in both wild-type (N2) and RNAi-sensitive strains (rrf-3)

  • CRISPR-Cas9 gene editing: For knockout or tagged protein generation

  • Protein-protein interaction studies:

    • Yeast two-hybrid (for soluble domains)

    • Membrane yeast two-hybrid (for membrane-embedded regions)

    • Co-immunoprecipitation followed by mass spectrometry

  • Phenotypic analysis: Assessing developmental, behavioral, or stress-response phenotypes

Similar methodologies have been successful in characterizing other putative membrane proteins in C. elegans where "knockdown of expression using RNAi made the worms more unhealthy on the pathogen" .

How can I design experiments to determine if C07A9.8 is involved in pathogen response?

To investigate pathogen response involvement:

  • Exposure assays: Challenge wild-type and C07A9.8 mutant worms with pathogens such as M. nematophilum or P. aeruginosa

  • Survival analysis: Compare survival curves between wild-type and mutant populations

  • Gene expression profiling: Analyze transcriptional changes using RNA-seq before and after pathogen exposure

  • Protein localization studies: Determine if protein relocalizes during infection

This experimental design mirrors established approaches where researchers found that specific genes were "important in the defense against M. nematophilum, since knockdown of expression using RNAi made the worms more unhealthy on the pathogen" .

What computational tools are recommended for predicting protein-protein interactions for C07A9.8?

For predicting protein-protein interactions, researchers should implement:

Tool/PlatformApplicationBenefits
STRINGInteraction network visualizationIntegrates multiple data sources
InterologFinderOrtholog-based predictionLeverages knowledge from better-studied organisms
HIPPIEHuman-focused interactomeImportant if studying human homologs
WormBaseC. elegans-specific databaseCurated genetic and physical interactions
ANIAAb initio predictionSuitable for novel proteins

These computational approaches should be validated experimentally, as "further experimental and computational studies can be done to assess the potentiality" of uncharacterized proteins .

What expression systems are optimal for producing recombinant C07A9.8 for structural studies?

For recombinant expression of membrane proteins like C07A9.8:

  • Bacterial systems:

    • E. coli strains C41(DE3) or C43(DE3) specifically engineered for membrane proteins

    • Fusion tags (MBP, SUMO) to enhance solubility

    • Temperature optimization (typically 18-25°C)

  • Eukaryotic systems:

    • Insect cells (Sf9, Hi5) for complex membrane proteins

    • Yeast expression (Pichia pastoris) for high-yield production

    • Mammalian cells for post-translational modifications

  • Cell-free systems:

    • Suitable for toxic proteins

    • Can directly incorporate detergents or lipids

Similar approaches have been used for other recombinant proteins where "HR1 recombinant proteins were added to cells cultured in a 96-well cell culture plate (8,000 cells per well) after serial dilution" .

How should I design cytotoxicity assays for recombinant C07A9.8?

When assessing potential cytotoxicity of recombinant C07A9.8:

  • Cell selection: Choose relevant cell lines (e.g., intestinal epithelial cells like Caco2)

  • Assay methodology:

    • CCK-8 assay for cell viability

    • LDH release for membrane integrity

    • Annexin V/PI staining for apoptosis detection

  • Experimental design:

    • Serial dilutions of protein (typically 0.1-100 μg/ml)

    • Incubation times ranging from 12-48 hours

    • Include positive controls (known cytotoxic agent)

    • Minimum three biological replicates

This protocol aligns with established methodologies where "cytotoxicity of recombinant proteins to Caco2 cells was tested by CCK-8... After incubating at 37°C for 12 h, medium was replaced with fresh MEM containing 10% FBS. Culturing continued for 48 h, and then CCK-8 solution was added" .

What statistical analyses are appropriate for C07A9.8 expression studies?

For robust statistical analysis of C07A9.8 expression data:

  • Primary statistical tests:

    • Student's t-test for comparing two conditions

    • ANOVA for multiple condition comparison

    • Post-hoc tests (Tukey's, Bonferroni) for pairwise comparisons

  • Software recommendations:

    • GraphPad Prism for analysis and visualization

    • R with Bioconductor packages for high-throughput data

    • DESeq2 or edgeR for RNA-seq differential expression

  • Significance reporting:

      • p < 0.05

    • ** p < 0.01

    • *** p < 0.001

    • **** p < 0.0001

This approach follows established protocols where "Student's t-test and Analysis of Variance (ANOVA) were used to compare the difference by GraphPad Prism 8" .

How can I determine if C07A9.8 is involved in proteostasis pathways?

To investigate C07A9.8's potential role in proteostasis:

  • Protein aggregation assays:

    • Cross with polyQ reporter strains (e.g., Q35-YFP, Q40-YFP)

    • Quantify aggregation in C07A9.8 knockdown/knockout backgrounds

    • Analyze age-dependent effects on aggregation

  • Heat stress experiments:

    • Compare survival rates following acute heat shock

    • Analyze recovery after thermal stress

    • Measure expression changes of known chaperones

  • Proteostasis network analysis:

    • Co-expression studies with known proteostasis components

    • Epistasis analysis with key regulators (HSF-1, DAF-16, PQM-1)

This approach is supported by research showing that "PQM-1 is required for C. elegans heat stress survival and that its presence helps suppress the aggregation of polyglutamine rich proteins" .

What techniques are recommended for studying subcellular localization of C07A9.8?

For determining subcellular localization:

  • Fluorescent protein tagging:

    • C-terminal or N-terminal GFP/mCherry fusion

    • Validation with multiple tag positions

    • Expression under native promoter

  • Immunofluorescence microscopy:

    • Generate specific antibodies against C07A9.8

    • Co-staining with organelle markers

    • Super-resolution microscopy for detailed localization

  • Subcellular fractionation:

    • Differential centrifugation

    • Gradient separation

    • Western blot analysis of fractions

When analyzing subcellular localization data, researchers should note that "the abundance of the protein and its subcellular localisation is influenced by both the ubiquitin ligase uba-1, and the kinase sgk-1" , suggesting potential regulatory mechanisms to consider.

How can I investigate potential transcriptional regulation by or of C07A9.8?

For transcriptional studies related to C07A9.8:

  • Promoter analysis:

    • Identification of regulatory elements

    • Reporter gene assays with promoter fragments

    • ChIP assays to identify transcription factors binding to C07A9.8 promoter

  • Transcriptome analysis:

    • RNA-seq comparing wild-type vs. C07A9.8 mutants

    • Condition-specific expression (heat stress, pathogen exposure)

    • Time-course experiments to capture temporal dynamics

  • Data interpretation:

    • Gene Ontology enrichment analysis

    • KEGG pathway mapping

    • Gene regulatory network construction

This approach aligns with similar studies where researchers "followed this result up with an appraisal of the transcriptome of C. elegans during heat stress, in the presence and absence of pqm-1 to ascertain which genes were regulated by PQM-1 during heat stress" .

What are the best approaches for studying potential antimicrobial functions of C07A9.8?

If investigating antimicrobial properties:

  • Pathogen susceptibility assays:

    • Survival assays on pathogenic bacteria

    • Colonization assays (CFU counts)

    • Pathogen avoidance behavior

  • Mechanistic studies:

    • Gene expression changes of antimicrobial effectors

    • Analysis of known antimicrobial pathways

    • Membrane permeability assays

  • Heterologous expression:

    • Expression in bacterial systems to test direct antimicrobial activity

    • Purification of peptide domains

    • MIC (Minimum Inhibitory Concentration) determination

This methodology is supported by research on C. elegans defense genes where "this set of 68 genes is strikingly enriched with certain protein domains, gene families, and proteins that have putative roles in defense" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.