Recombinant Uncharacterized protein F02A9.1 (F02A9.1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please inform us in advance; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
F02A9.1; Uncharacterized protein F02A9.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-200
Protein Length
Full Length of Mature Protein
Species
Caenorhabditis elegans
Target Names
F02A9.1
Target Protein Sequence
INNQNSRYDKMFLAMVCQDQNGCEVNIRFLKQSFPDSNSTEPLYEHTMIYNNGSLDEITI DVTEDVNIIEFTFTAPDENGTTIVETDSWELNFSETYFHTIGSLQLVGNLPCGRYGCPQT PLCNGSCRFMVIVSLAAFCISVLAGLALQTVYVSFLGFRKTRKAVELRDTLRLTEAAELA H
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_F02A9.1

STRING: 6239.F02A9.1

UniGene: Cel.10636

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What experimental approaches should be prioritized when working with uncharacterized protein F02A9.1?

When working with an uncharacterized protein like F02A9.1, researchers should implement a systematic characterization workflow. Begin with sequence analysis using bioinformatics tools to identify conserved domains and potential functional motifs. Following computational analysis, express the recombinant protein in a suitable host system, such as E. coli or yeast expression systems for initial biochemical characterization.

A robust experimental design requires defining clear variables related to the protein's function. Similar to approaches used with other uncharacterized proteins, you should:

  • Define your independent variables (expression conditions, potential substrates, interacting partners)

  • Establish measurable dependent variables (enzymatic activity, binding affinity, structural changes)

  • Control extraneous variables that might influence results

  • Formulate specific, testable hypotheses based on sequence predictions

For functional characterization, employ a combination of biochemical assays, structural studies, and protein-protein interaction analyses to gradually build a functional profile. This multi-faceted approach increases the likelihood of discovering the protein's biological role.

How can bioinformatic analysis guide initial characterization of F02A9.1?

Bioinformatic analysis serves as a crucial first step in characterizing proteins like F02A9.1. Begin with sequence alignment tools such as BLAST to identify homologous proteins across species. Structure prediction algorithms like Phyre2 can reveal potential structural domains, similar to how researchers identified SANT and BTB domains in the previously uncharacterized protein SANBR .

For F02A9.1, particular attention should be paid to identifying:

  • Conserved domains that may suggest function

  • Signal peptides indicating cellular localization

  • Transmembrane regions suggesting membrane association

  • Post-translational modification sites

  • Evolutionary conservation patterns across nematode species

What expression systems are most appropriate for recombinant production of F02A9.1?

The choice of expression system for F02A9.1 should be guided by the protein's properties and research objectives. Based on approaches used for similar uncharacterized proteins, consider these options:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, rapid growth, economicalLimited post-translational modificationsInitial biochemical studies, structural analysis
Yeast (S. cerevisiae, P. pastoris)Eukaryotic PTMs, secretion possibleLower yields than bacteriaFunctional studies requiring PTMs
Insect cellsComplex eukaryotic PTMs, high solubilityMore expensive, slowerProteins requiring extensive folding assistance
Mammalian cellsNative-like processing and foldingHighest cost, lowest yieldFunctional studies in physiological context

For initial characterization of F02A9.1, an E. coli-based system with an N-terminal affinity tag (His6) often provides sufficient material for preliminary biochemical and structural studies. If functional assays reveal activity issues, progression to eukaryotic systems may be warranted. When designing expression constructs, consider including protease cleavage sites to remove tags that might interfere with function .

How should researchers design experiments to determine if F02A9.1 contains functional domains similar to SANT or BTB domains found in other regulatory proteins?

To investigate whether F02A9.1 contains functional domains similar to SANT or BTB domains (as found in proteins like SANBR), researchers should implement a comprehensive experimental strategy that combines computational, biochemical, and functional approaches.

First, conduct rigorous computational analysis using specialized structure prediction tools like Phyre2, which successfully identified these domains in previously uncharacterized proteins . Look specifically for sequence signatures consistent with SANT domains (which typically mediate protein-histone interactions) and BTB domains (involved in protein-protein interactions and transcriptional regulation).

For experimental validation, design the following experiments:

  • Domain-specific binding assays: Test F02A9.1 interaction with histone tails (for SANT domains) and transcriptional regulators (for BTB domains) using pull-down assays or surface plasmon resonance.

  • Truncation studies: Generate a series of truncated F02A9.1 constructs that systematically remove predicted domains to assess their contribution to protein function.

  • Point mutation analysis: Introduce targeted mutations in conserved residues within predicted domains and measure effects on function.

  • Dimerization assays: If BTB domains are predicted, test for protein dimerization using techniques like size exclusion chromatography, analytical ultracentrifugation, or in vivo dimerization assays similar to those used for SANBR characterization .

These approaches should be conducted in parallel with control experiments using well-characterized SANT and BTB domain-containing proteins to ensure valid comparisons.

What strategies can resolve contradictory data when characterizing F02A9.1 function?

When faced with contradictory data during F02A9.1 characterization, implement a systematic troubleshooting approach. First, categorize the contradictions as methodological (arising from different experimental approaches), biological (reflecting genuine complexity), or technical (resulting from experimental error).

For methodological contradictions:

  • Compare experimental conditions across studies, including expression systems, purification methods, and assay conditions

  • Standardize protocols to minimize variables

  • Perform direct side-by-side comparisons under identical conditions

For biological contradictions:

  • Consider if F02A9.1 might have multiple functions or context-dependent activities

  • Investigate if post-translational modifications alter function

  • Examine if binding partners present in different experiments affect activity

For technical contradictions:

  • Assess protein quality (purity, folding, aggregation state)

  • Verify reagent integrity and specificity

  • Increase statistical power with additional replicates

  • Employ orthogonal techniques to validate findings

When working with multi-domain proteins like F02A9.1, contradictions may arise from domain-specific functions. Similar to studies of SANBR protein, which contains both SANT and BTB domains with distinct roles, segregate functional analysis by domain to resolve apparent contradictions . Document all contradictory findings transparently in publications rather than selectively reporting only consistent results.

How can researchers effectively employ SL1-capped cDNA libraries for identifying F02A9.1 interaction partners?

SL1-capped cDNA libraries represent a valuable resource for identifying potential interaction partners of F02A9.1, particularly in nematode systems where trans-splicing is common. Based on approaches used for other uncharacterized proteins, researchers should follow this methodological framework:

  • Library construction: Generate SL1-capped cDNA libraries from tissues or developmental stages where F02A9.1 is expressed. Ensure high-quality RNA isolation and efficient cDNA synthesis using methods similar to those described for A. ceylanicum, which involved careful elimination of over-amplified PCR products and validation through sequencing .

  • Yeast two-hybrid screening: Construct a bait vector containing F02A9.1 and screen against the SL1-capped cDNA library to identify interacting partners.

  • Co-immunoprecipitation validation: Confirm interactions identified from the screen using co-immunoprecipitation experiments with tagged versions of F02A9.1 and candidate interactors.

  • Functional correlation analysis: Analyze whether identified interactors belong to specific functional pathways, similar to how researchers discovered that SANBR interacts with proteins involved in IL4 and cytokine signaling pathways .

When analyzing results, pay particular attention to developmentally regulated or stage-specific interactions, especially those involving taxonomically restricted genes that may have specialized functions. The identification of interaction networks has proven valuable for characterizing previously uncharacterized proteins by placing them in functional context .

What statistical approaches are most appropriate for analyzing F02A9.1 functional assay data?

For comparing F02A9.1 activity across different conditions:

  • Two-group comparisons: Use t-tests for normally distributed data or Mann-Whitney U tests for non-parametric data

  • Multiple group comparisons: Employ ANOVA followed by post-hoc tests (Tukey, Bonferroni) for normally distributed data or Kruskal-Wallis with Dunn's test for non-parametric data

  • Dose-response relationships: Apply regression analysis or nonlinear curve fitting

When analyzing protein-protein interactions or binding assays:

  • Calculate binding constants (Kd, Ka) using appropriate binding models

  • Use bootstrapping methods to generate confidence intervals

  • Compare binding parameters across conditions using appropriate statistical tests

For high-throughput data (e.g., proteomic interactions):

  • Apply multiple testing correction (Benjamini-Hochberg procedure)

  • Use False Discovery Rate (FDR) control, typically at 10% as used in shRNA screens for uncharacterized proteins

  • Implement dimensionality reduction techniques for visualizing complex datasets

Whatever statistical approach is chosen, ensure adequate sample size by performing power analysis during experimental planning. Report effect sizes alongside p-values, and transparently document all data transformations and statistical assumptions in publications.

How can genomic mapping approaches be used to understand F02A9.1 gene structure and expression patterns?

Genomic mapping provides critical insights into F02A9.1 gene structure, regulation, and expression patterns. Based on approaches used for similar uncharacterized proteins, implement the following methodology:

  • Scaffold mapping: Map F02A9.1 sequences to genomic scaffolds to identify the complete gene structure, including exons, introns, and regulatory regions. This approach revealed important insights about gene duplication in A. ceylanicum, where researchers discovered that certain uncharacterized proteins were encoded by duplicated genes located within a 1MB interval on a single genomic scaffold .

  • Promoter analysis: Identify regulatory elements upstream of F02A9.1 using tools like JASPAR and TRANSFAC, followed by experimental validation through reporter assays.

  • Expression profiling: Analyze F02A9.1 expression across tissues and developmental stages using:

    • RNA-Seq for broad transcriptomic profiling

    • qRT-PCR for targeted expression analysis

    • In situ hybridization for spatial localization

  • Chromatin state analysis: Perform ChIP-seq to identify histone modifications and transcription factor binding sites associated with F02A9.1, particularly relevant if computational analysis suggests regulatory domains.

When analyzing gene duplication events, carefully distinguish between closely related paralogs, as seen in the analysis of LKIN-motif family members in A. ceylanicum . For F02A9.1, determine if it belongs to a gene family with locally duplicated members, which may indicate functional specialization or redundancy. This information is crucial for genetic manipulation experiments, as redundant family members may compensate for F02A9.1 knockout.

What control experiments are essential when studying the potential regulatory functions of F02A9.1?

  • Expression level controls:

    • Verify that experimental overexpression or knockdown of F02A9.1 achieves desired levels using both mRNA and protein quantification

    • Include empty vector controls for overexpression studies

    • Implement non-targeting shRNA/siRNA controls for knockdown experiments

  • Specificity controls:

    • Use multiple independent siRNAs/shRNAs targeting different regions of F02A9.1 to confirm phenotypic effects

    • Perform rescue experiments with shRNA-resistant F02A9.1 constructs to verify specificity

    • Include related family members to determine function specificity

  • Functional pathway controls:

    • Measure established markers of relevant pathways (similar to how researchers monitored germline transcription, AID expression, and B cell proliferation when studying SANBR )

    • Include positive control proteins with known functions in the pathway

    • Perform parallel experiments with known regulators (both positive and negative)

  • Domain-specific controls:

    • Generate domain deletion mutants to identify functional domains

    • Create point mutations in conserved residues to validate domain function

    • Swap domains with those from related proteins to test functional conservation

Remember that control experiments must be conducted under identical conditions as experimental samples, including cell type, treatment duration, and analytical methods. Report all control data alongside experimental results, even when controls show no significant differences.

How should researchers design experiments to determine if F02A9.1 is involved in transcriptional regulation?

To investigate F02A9.1's potential role in transcriptional regulation, particularly if it contains domains similar to SANT or BTB domains found in transcriptional regulators , design experiments that systematically evaluate its influence on gene expression at multiple levels:

  • Subcellular localization studies

    • Perform immunofluorescence or live cell imaging with tagged F02A9.1 to determine if it localizes to the nucleus

    • Use nuclear fractionation followed by Western blotting to quantify nuclear vs. cytoplasmic distribution

    • Create deletion constructs to identify nuclear localization signals

  • Chromatin association analysis

    • Conduct ChIP-seq to map F02A9.1 binding sites across the genome

    • Perform sequential ChIP (re-ChIP) to determine co-occupancy with known transcription factors

    • Use ChIP-qPCR to validate binding at specific candidate target genes

  • Transcriptional activity assays

    • Implement reporter gene assays using promoters of potential target genes

    • Create F02A9.1 fusions with Gal4 DNA binding domain to test intrinsic activation/repression potential

    • Perform RNA-seq after F02A9.1 manipulation to identify affected gene networks

  • Mechanistic investigations

    • Use co-immunoprecipitation to identify interactions with transcriptional machinery components

    • Perform histone modification ChIP after F02A9.1 manipulation to assess effects on chromatin state

    • Use in vitro transcription assays with purified components to test direct effects

Following the between-subjects or within-subjects experimental design principles , manipulate F02A9.1 levels (independent variable) and measure effects on transcriptional outputs (dependent variables) while controlling for confounding factors. Construct experiments to distinguish direct versus indirect effects by incorporating time-course analyses and immediate-early gene response measurements.

How can genome editing techniques be optimized for studying F02A9.1 function in model organisms?

Optimizing genome editing techniques for F02A9.1 functional studies requires careful consideration of the model organism, editing strategy, and phenotypic analysis. Follow these methodological guidelines:

  • CRISPR-Cas9 design for F02A9.1 editing:

    • Design multiple guide RNAs targeting conserved functional domains

    • Validate guide RNA efficiency using in vitro cleavage assays

    • Consider potential off-target effects using computational prediction tools

    • For precise mutations, design appropriate repair templates

  • Organism-specific optimization:

    • For nematode models (C. elegans): Use microinjection of ribonucleoprotein complexes into the gonad

    • For cell culture models: Optimize transfection/electroporation conditions for each cell type

    • For vertebrate models: Consider tissue-specific or inducible knockout strategies

  • Validation strategies:

    • Confirm edits by sequencing the genomic locus

    • Verify protein loss by Western blotting or immunostaining

    • Screen for potential compensatory expression of related family members

    • Check for unintended effects on neighboring genes

  • Phenotypic characterization:

    • Design a systematic pipeline for assessing developmental, cellular, and molecular phenotypes

    • Include quantitative assays relevant to predicted F02A9.1 function

    • Perform rescue experiments with wild-type and mutant F02A9.1 variants

When studying proteins with potential roles in gene regulation, like those containing SANT domains (as identified in other previously uncharacterized proteins ), implement RNA-seq or targeted gene expression analysis to identify transcriptional changes resulting from F02A9.1 disruption. This approach helps place the protein within specific regulatory pathways.

What mass spectrometry approaches are most effective for identifying post-translational modifications on F02A9.1?

Post-translational modifications (PTMs) can significantly impact protein function, particularly for regulatory proteins. To comprehensively characterize PTMs on F02A9.1, implement this systematic mass spectrometry workflow:

  • Sample preparation optimization:

    • Express and purify F02A9.1 from relevant biological contexts (recombinant systems and native sources if possible)

    • Implement enrichment strategies for specific PTMs (phosphopeptide enrichment, ubiquitin remnant antibodies)

    • Use multiple proteases (trypsin, chymotrypsin, Glu-C) to maximize sequence coverage

  • MS acquisition strategies:

    • Perform initial discovery using data-dependent acquisition (DDA)

    • Implement parallel reaction monitoring (PRM) or multiple reaction monitoring (MRM) for targeted analysis of identified modifications

    • Use electron transfer dissociation (ETD) alongside collision-induced dissociation (CID) for improved PTM localization

  • Data analysis pipeline:

    • Search against appropriate databases with variable modifications

    • Apply strict false discovery rate controls (1% PSM level)

    • Manually validate all identified PTM spectra

    • Quantify modification stoichiometry where possible

  • Functional validation:

    • Generate site-specific mutants (Ser→Ala for phosphorylation, Lys→Arg for ubiquitination)

    • Compare activity of wild-type and PTM-deficient mutants

    • Identify enzymes responsible for adding/removing modifications

PTM TypeEnrichment MethodSpecialized MS ApproachCommon Sites
PhosphorylationTiO2, IMAC, phospho-antibodiesNeutral loss scanningSer, Thr, Tyr
UbiquitinationK-ε-GG antibodiesMiddle-down MSLys
AcetylationAcetyl-Lys antibodiesETD fragmentationLys
MethylationMethyl-specific antibodiesHigh-resolution MSLys, Arg
GlycosylationLectin affinity, HILICEThcD fragmentationAsn, Ser, Thr

This comprehensive approach has been successfully applied to characterize PTMs on previously uncharacterized proteins, revealing functional regulatory mechanisms that would be missed by standard protein analysis methods.

What strategies can overcome challenges in expressing soluble, functional recombinant F02A9.1?

Expressing soluble, functional recombinant uncharacterized proteins like F02A9.1 frequently presents challenges. Based on experience with similar proteins, implement this systematic troubleshooting workflow:

  • Expression construct optimization:

    • Test multiple affinity tags (His6, GST, MBP, SUMO) at both N- and C-termini

    • Create truncated constructs based on domain predictions to identify soluble domains

    • Optimize codon usage for the expression host

    • Include solubility-enhancing fusion partners (e.g., MBP, NusA)

  • Expression condition screening:

    • Test multiple E. coli strains (BL21(DE3), Rosetta, Arctic Express, SHuffle)

    • Perform temperature optimization (37°C, 30°C, 25°C, 18°C, 16°C)

    • Vary induction parameters (IPTG concentration, induction time)

    • Screen autoinduction media formulations

  • Solubilization strategies:

    • Optimize lysis buffer conditions (pH, salt concentration, additives)

    • Test various detergents for membrane-associated proteins

    • Add stabilizing co-factors or ligands if predicted by sequence analysis

    • Implement on-column refolding for inclusion body purification

  • Quality assessment:

    • Analyze protein by size exclusion chromatography to verify monodispersity

    • Use thermal shift assays to identify stabilizing buffer conditions

    • Implement light scattering techniques to assess oligomeric state

    • Verify folding with circular dichroism spectroscopy

The selection of expression system significantly impacts success rates with uncharacterized proteins. If prokaryotic expression fails, consider eukaryotic systems that provide appropriate post-translational modifications and chaperone assistance. For proteins with predicted domains similar to SANT or BTB , co-expression with binding partners may stabilize the protein and enhance solubility.

How can researchers interpret unexpected localization patterns of F02A9.1 in cellular studies?

Unexpected localization patterns of F02A9.1 in cellular studies require systematic analysis to distinguish between biological insights and technical artifacts. Follow this methodological framework:

  • Validation of localization findings:

    • Confirm observations using multiple detection methods (different antibodies, tags positioned at different termini)

    • Compare fixed vs. live cell imaging to rule out fixation artifacts

    • Use subcellular fractionation followed by Western blotting as biochemical validation

    • Verify findings in multiple cell types/tissues to assess context-dependence

  • Analysis of potential mechanisms:

    • Examine sequence for cryptic localization signals using specialized prediction algorithms

    • Identify potential post-translational modifications that might regulate localization

    • Consider dynamic localization in response to cellular stimuli or cell cycle phases

    • Investigate whether interacting partners influence localization patterns

  • Domain-specific localization analysis:

    • Create deletion constructs to map regions responsible for unexpected localization

    • Generate chimeric proteins with well-characterized localization signals

    • Perform time-lapse imaging to capture dynamic localization changes

    • Use optogenetic approaches to artificially alter localization and observe functional consequences

  • Functional correlation:

    • Determine if unexpected localization correlates with specific cellular functions

    • Investigate similar localization patterns in functionally related proteins

    • Test whether disrupting localization affects protein function using targeted mutations

For example, if a protein predicted to be nuclear shows unexpected cytoplasmic localization, investigate whether this represents a shuttling mechanism, cytoplasmic retention before activation, or potentially reveals a novel function. Similar to how SANBR was found to have functions related to its specific subcellular distribution , unexpected localization of F02A9.1 may provide critical clues about its biological role.

How can high-throughput screening approaches be designed to identify the function of F02A9.1?

High-throughput screening (HTS) approaches offer powerful strategies for identifying functions of uncharacterized proteins like F02A9.1. Design your screening campaign using this methodological framework:

  • Phenotypic screening design:

    • Create cell lines with modulated F02A9.1 expression (overexpression, knockdown, knockout)

    • Develop quantifiable phenotypic readouts (reporter genes, cellular morphology, survival)

    • Optimize assay for miniaturization and automation (384 or 1536-well format)

    • Establish robust statistical parameters (Z-factor >0.5, signal-to-background >3)

  • Screening library selection:

    • For functional pathways: Use focused shRNA/CRISPR libraries targeting specific pathways

    • For protein interactions: Design protein fragment libraries or domain-specific variants

    • For chemical biology: Select compound libraries based on predicted protein features

    • For genetic interactions: Implement synthetic lethality screens with systematic gene knockdowns

  • Analysis pipeline implementation:

    • Develop automated image analysis workflows for phenotypic screens

    • Apply appropriate statistical methods (strictly control false discovery rate at 10% as used in similar screens )

    • Implement clustering algorithms to identify functional patterns

    • Design secondary validation assays for hit confirmation

  • Validation strategies:

    • Confirm hits with orthogonal assays and methodologies

    • Test dose-response relationships for chemical screens

    • Validate genetic interactions with individual knockout/knockdown experiments

    • Perform epistasis analysis to place F02A9.1 within signaling pathways

The shRNA screening approach that successfully identified the function of previously uncharacterized proteins like SANBR provides an excellent methodological template. This approach revealed SANBR as a negative regulator of CSR based on selection criteria of targeting shRNAs with log2(Cy3/Cy5) > 1 at 10% FDR. Similar quantitative thresholds should be established for F02A9.1 functional screens.

What computational approaches can predict F02A9.1 function based on its sequence and structural features?

Computational prediction of F02A9.1 function requires integrating multiple bioinformatic approaches to generate testable hypotheses. Implement this comprehensive analytical pipeline:

  • Sequence-based analysis:

    • Perform sensitive homology detection using PSI-BLAST, HHpred, and HMMER

    • Identify conserved domains through comparison with domain databases (Pfam, InterPro, CDD)

    • Analyze sequence for functionally important motifs (catalytic sites, binding motifs)

    • Assess evolutionary conservation patterns across species using ConSurf or Rate4Site

  • Structural prediction and analysis:

    • Generate 3D structural models using AlphaFold2 or RoseTTAFold

    • Validate models using MolProbity and structural assessment tools

    • Identify potential binding pockets and functional sites using CASTp and SiteMap

    • Perform structural alignment with characterized proteins to identify functional analogs

  • Network-based predictions:

    • Construct protein-protein interaction networks from experimental and predicted data

    • Apply guilt-by-association methods to predict function from interaction partners

    • Analyze co-expression patterns across diverse datasets

    • Implement gene neighborhood analysis for prokaryotic homologs if applicable

  • Integrative functional prediction:

    • Combine predictions from multiple methods using ensemble approaches

    • Apply machine learning techniques trained on proteins with known functions

    • Calculate confidence scores for different functional hypotheses

    • Generate specific, testable predictions for experimental validation

This approach successfully identified SANT and BTB domains in the previously uncharacterized protein SANBR using structure prediction by Phyre2 , leading to functional insights. For F02A9.1, integrate predictions across multiple tools and databases to build a consensus functional hypothesis, remembering that computational predictions require experimental validation.

What role might F02A9.1 play in gene regulation networks based on domain predictions?

If domain analysis suggests F02A9.1 contains regulatory domains similar to SANT and BTB domains found in other proteins , it likely functions within gene regulation networks. Based on the roles of these domains in other proteins, researchers should investigate these potential mechanisms:

  • Chromatin remodeling functions:

    • SANT domains typically interact with histone tails and regulate chromatin-modifying complexes

    • Test F02A9.1 interactions with histone deacetylase complexes, as many SANT domain proteins serve as interaction platforms

    • Investigate associations with nucleosome remodeling factors through co-immunoprecipitation and functional assays

    • Examine effects of F02A9.1 manipulation on chromatin accessibility using ATAC-seq

  • Transcriptional regulation mechanisms:

    • BTB domains often mediate protein dimerization and recruitment of co-repressors

    • Assess F02A9.1 interactions with known transcriptional machinery components

    • Identify potential DNA binding capabilities through electrophoretic mobility shift assays

    • Perform RNA-seq after F02A9.1 depletion to identify regulated gene networks

  • Signaling pathway integration:

    • Many BTB domain proteins function as substrate recognition components of E3 ubiquitin ligases

    • Test F02A9.1 association with Cullin-based ubiquitin ligase complexes

    • Identify potential substrates using proteomics approaches following F02A9.1 manipulation

    • Investigate connections to signaling pathways similar to how SANBR was linked to IL4 and cytokine signaling

  • Developmental regulation potential:

    • Analyze spatiotemporal expression patterns of F02A9.1 during development

    • Investigate phenotypic consequences of F02A9.1 depletion on developmental processes

    • Examine genetic interactions with known developmental regulators

    • Consider potential evolutionary specialization if F02A9.1 belongs to a gene family with local duplications

Researchers should design experiments that systematically test these hypotheses, recognizing that proteins with similar domains often perform context-specific functions within the broader framework of gene regulation.

How can comparative genomics approaches enhance understanding of F02A9.1 function across species?

Comparative genomics provides powerful insights into F02A9.1 function by placing it in an evolutionary context. Implement this methodological framework:

  • Ortholog identification and analysis:

    • Identify F02A9.1 orthologs across nematode species and, if present, in more distant taxa

    • Distinguish between orthologs and paralogs through phylogenetic analysis

    • Compare gene structures to identify conserved exon-intron boundaries and alternative splicing

    • Analyze synteny patterns to detect genomic rearrangements affecting the F02A9.1 locus

  • Evolutionary rate analysis:

    • Calculate selection pressures (dN/dS ratios) across different regions of the protein

    • Identify sites under positive or purifying selection using codon-based models

    • Compare evolutionary rates between functional domains and linking regions

    • Analyze whether F02A9.1 has undergone accelerated evolution in specific lineages

  • Functional element conservation:

    • Compare promoter regions to identify conserved transcription factor binding sites

    • Analyze conservation of splicing regulatory elements

    • Identify conserved RNA structural elements in untranslated regions

    • Map conservation onto predicted protein structure to identify functional surfaces

  • Genomic context integration:

    • Examine if F02A9.1 is part of a locally duplicated gene family, similar to patterns observed in A. ceylanicum

    • Analyze if F02A9.1 shows conserved co-expression with specific gene sets across species

    • Investigate whether F02A9.1 is part of conserved operons in nematodes

    • Determine if genomic context provides clues about functional associations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.