Recombinant Uncharacterized protein F46C5.2 (F46C5.2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize development of your specified tag.
Synonyms
F46C5.2; Uncharacterized protein F46C5.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-202
Protein Length
Full Length of Mature Protein
Species
Caenorhabditis elegans
Target Names
F46C5.2
Target Protein Sequence
QMTCEEFELENTESLVECVQCVQLWRSASAKEGKVCTSGATTCKGNACFMRQCKHCPVYQ YMSGCVNFSPWQLADLEMNRRTSELRMRRVGAVLLCEDTFNQTTCVCNRRDKCNDIHSRL PFATYAEGLFRGVVNFDTIIAAIDPRYLEVMSGYHFRFLASSSSSFSSFLPSIAIILFFV LSH
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_F46C5.2

STRING: 6239.F46C5.2.2

UniGene: Cel.15074

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is F46C5.2 and what are its basic characteristics?

F46C5.2 is an uncharacterized protein from Caenorhabditis elegans. It is a full-length mature protein spanning amino acids 20-202. While its function remains largely unknown, it can be successfully expressed as a recombinant protein with histidine tags in prokaryotic expression systems like E. coli . As an uncharacterized protein, F46C5.2 represents one of the many proteins in C. elegans that have not yet been functionally annotated despite the organism's extensive use as a model system.

What expression systems are most effective for producing recombinant F46C5.2?

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, cost-effective, rapid productionMay lack post-translational modifications, potential endotoxin contaminationBasic structural studies, antibody production
YeastEukaryotic post-translational modifications, secretion capabilityLower yields than E. coli, longer production timeFunctional studies requiring certain modifications
BaculovirusComplex eukaryotic modifications, high-level expressionTechnical complexity, higher costStudies requiring authentic protein folding
Mammalian CellMost authentic post-translational modificationsHighest cost, lowest yield, technical difficultyInteraction studies with mammalian partners

When choosing an expression system, consider that Gram-positive bacteria may be superior alternatives to E. coli for producing LPS-free recombinant proteins, particularly when the proteins will be used for immunological studies .

What experimental design is most appropriate for studying an uncharacterized protein like F46C5.2?

For uncharacterized proteins like F46C5.2, a systematic experimental approach is recommended:

  • True experimental designs with treatment manipulation and random assignment are optimal for establishing causality in functional studies .

  • A reverse genetic approach is particularly valuable, following these steps:

    • Generate or obtain knockout/knockdown strains (RNAi-based methods are effective in C. elegans)

    • Examine phenotypic effects under various conditions (bacterial infection, UV irradiation, thermal stress)

    • Compare juvenile and adult animals to assess age-dependent functions

  • Functional complementation experiments can help determine whether F46C5.2 can rescue phenotypes associated with known gene mutations.

The experimental design should include appropriate controls and sufficient replication to ensure statistical validity. For example, when using RNAi to knock down F46C5.2, researchers should include control RNAi treatments targeting non-related genes .

How should RNAi experiments be designed to study F46C5.2 function in C. elegans?

RNAi experiments targeting F46C5.2 should follow these methodological guidelines:

  • RNAi sequence verification: Confirm all RNAi sequences by sequencing prior to use .

  • Culture preparation:

    • Streak bacteria from an RNAi library onto LB plates containing appropriate antibiotics (ampicillin 50μg/mL and tetracycline 1.25μg/mL)

    • Incubate overnight at 37°C

    • Inoculate a single colony into LB with ampicillin (1ng/mL)

    • After overnight growth, centrifuge at 5,000g for 10 minutes

    • Resuspend in LB containing ampicillin

    • Seed RNAi plates (standard NGM with 1mg/mL carbenicillin, 2μM IPTG)

  • Worm treatment:

    • Transfer synchronized L1 larvae to RNAi plates

    • Maintain at 20°C until L4 stage

    • Transfer to pre-seeded RNAi plates containing 25 μg/mL FUdR (5-fluorodeoxyuridine)

    • For genes essential for development, initiate knockdown at L4 stage

  • Phenotype assessment:

    • Examine resistance to bacterial infection, UV irradiation, and thermal stress

    • For infection assays, transfer worms to plates containing pathogenic bacteria (e.g., P. aeruginosa strain PA14)

    • Monitor survival by scoring responsiveness to gentle prodding with a wire pick

What methods can be used to determine the potential function of uncharacterized protein F46C5.2?

Several complementary approaches can help elucidate the function of F46C5.2:

  • Sequence-based analysis:

    • Perform multiple sequence alignments using tools like Clustal Omega to identify conserved domains

    • Compare with homologous proteins from other species

    • Identify conserved residues and motifs that may indicate function

  • Expression pattern analysis:

    • Generate transgenic C. elegans expressing F46C5.2::GFP fusion to visualize tissue-specific expression

    • Analyze expression patterns under different conditions and developmental stages

  • Interactome analysis:

    • Conduct yeast two-hybrid screens to identify protein-protein interactions

    • Perform co-immunoprecipitation with epitope-tagged F46C5.2

    • Use mass spectrometry to identify binding partners

  • Phenotypic analysis of F46C5.2 knockdown/knockout:

    • Examine effects on development, lifespan, stress resistance, and response to pathogens

    • Study behavioral phenotypes including locomotion, feeding, and reproduction

  • Transcriptomic analysis:

    • Perform RNA-seq to identify genes differentially expressed in F46C5.2 mutants

    • This may reveal biological pathways affected by F46C5.2 function

How can researchers assess if F46C5.2 plays a role in C. elegans immune response to bacterial pathogens?

To determine if F46C5.2 is involved in immune response to bacterial pathogens, implement the following experimental approach:

  • Infection assays with pathogenic bacteria:

    • Prepare slow-kill assay plates seeded with pathogenic bacteria (e.g., P. aeruginosa strain PA14)

    • Incubate plates for one night at 37°C followed by one night at room temperature

    • Transfer both wild-type and F46C5.2 RNAi-treated or mutant worms to infection plates

    • Include FUdR (25 μg/mL) to prevent progeny production

    • Monitor survival twice daily by counting responsive animals

  • Tissue-specific colonization assessment:

    • Use GFP-labeled bacteria to visualize colonization patterns

    • Compare bacterial accumulation in intestinal lumen between wild-type and F46C5.2-deficient worms

    • Employ transmission electron microscopy (TEM) to examine intestinal epithelial integrity and bacterial invasion

  • Immune response marker analysis:

    • Measure expression of antimicrobial peptides and other immune effectors

    • Analyze DAF-16 nuclear localization, which is associated with stress and immune responses

    • Examine involvement in known immune pathways such as p38 MAPK and insulin-like signaling

How should researchers design experiments to study potential interactions between F46C5.2 and phosphoprotein phosphatase complexes?

Evidence suggests phosphoprotein phosphatase (PPP) complexes play important roles in C. elegans stress responses and pathogen resistance . To investigate potential interactions between F46C5.2 and PPP complexes:

  • Co-expression analysis:

    • Simultaneously knock down F46C5.2 and PPP complex components (e.g., LET-92, PPH-4.1, PPH-4.2, PPH-6)

    • Compare phenotypes of single and double knockdowns to identify genetic interactions

    • Assess effects on stress resistance and pathogen susceptibility

  • Protein-protein interaction studies:

    • Express tagged versions of F46C5.2 and PPP components

    • Perform co-immunoprecipitation followed by western blotting

    • Use proximity ligation assays to detect in vivo interactions

  • Phosphorylation state analysis:

    • Compare phosphoproteomic profiles between wild-type and F46C5.2-deficient animals

    • Analyze whether F46C5.2 is itself a substrate of PPP complexes

    • Investigate if F46C5.2 affects phosphorylation of known PPP targets

What experimental approaches can distinguish between direct and indirect effects of F46C5.2 on phenotypes observed in knockout/knockdown studies?

Distinguishing direct from indirect effects requires sophisticated experimental designs:

  • Temporal control of gene expression:

    • Use temperature-sensitive alleles or inducible RNAi systems

    • Implement conditional expression systems to turn F46C5.2 on/off at specific times

    • Observe immediate versus delayed phenotypic changes following manipulation

  • Tissue-specific manipulation:

    • Express F46C5.2 under tissue-specific promoters in a null background

    • Use tissue-specific RNAi to knock down F46C5.2 in distinct cell types

    • Determine which tissues require F46C5.2 for specific phenotypes

  • Structure-function analysis:

    • Create point mutations or deletion constructs affecting specific domains

    • Express these variants in a null background to identify critical functional regions

    • Correlate structural features with specific phenotypic outcomes

  • Biochemical validation:

    • Perform in vitro assays with purified recombinant F46C5.2 protein

    • Test direct biochemical activities suggested by in vivo studies

    • Validate protein-protein interactions using purified components

What are the best practices for analyzing and presenting data from F46C5.2 functional studies?

When analyzing and presenting data from F46C5.2 studies, follow these research-grade practices:

  • Statistical analysis considerations:

    • For survival analyses, use Kaplan-Meier curves and log-rank tests

    • For quantitative measurements, apply appropriate tests based on data distribution (t-tests, ANOVA, non-parametric alternatives)

    • Include sample sizes, p-values, and confidence intervals with all statistical analyses

  • Data table presentation guidelines:

    • Tables should be self-explanatory without requiring text references

    • Include total number of observations (N) in titles or table bodies

    • Standardize decimal places across all cells

    • Use three horizontal lines (top, after headers, bottom) without vertical lines

    • Present both absolute and relative frequencies for categorical data

Example of proper categorical data presentation:

PhenotypeAbsolute frequency (n)Relative frequency (%)
Wild-type15879.0
Abnormal4221.0
Total200100.0
  • Graphical representation recommendations:

    • Use bar charts for categorical data and histograms for continuous numerical data

    • Ensure vertical axes always start at zero to avoid distortion

    • Clearly label axes with variables and units

    • Include appropriate legends identifying all data elements

    • Make figures self-explanatory with comprehensive captions

How should researchers interpret and address contradictory results in F46C5.2 studies?

When facing contradictory results in F46C5.2 research:

  • Systematic validation approach:

    • Verify reagent specificity (antibodies, RNAi constructs, CRISPR designs)

    • Confirm genetic backgrounds and rule out genetic modifiers

    • Test across multiple experimental conditions and developmental stages

    • Use complementary techniques to assess the same endpoint

  • Controlled variable identification:

    • Implement factorial experimental designs to identify interacting variables

    • Systematically vary experimental conditions to determine context-dependence

    • Consider temperature, food source, and developmental timing as potential variables

  • Strain-specific effects analysis:

    • Compare results across different C. elegans strains (N2, Hawaiian, etc.)

    • Test for genetic background interactions that may explain contradictions

    • Consider natural variation in F46C5.2 sequence or regulation

  • Transparent reporting:

    • Document all contradictory findings in publications

    • Present alternative interpretations of conflicting data

    • Suggest specific experiments that could resolve contradictions

How does F46C5.2 compare to other uncharacterized proteins in the F46C5 gene family?

The F46C5 gene family in C. elegans contains several uncharacterized proteins. A comparative analysis reveals:

  • Sequence similarity analysis:

    • F46C5.2 shares limited sequence homology with F46C5.7, another uncharacterized protein

    • Both proteins belong to the same genomic region, suggesting possible evolutionary relationships

    • Sequence alignment shows distinct domains that may indicate specialized functions

  • Expression pattern comparison:

    • F46C5 family members show distinct tissue-specific expression patterns

    • Temporal expression profiles during development vary between family members

    • Co-expression analysis may reveal functional relationships with characterized genes

  • Phenotypic comparison of gene knockdowns:

    • RNAi phenotypes differ between F46C5 family members

    • Some family members may show redundant functions, requiring double knockdowns to reveal phenotypes

    • Cross-rescue experiments can determine functional conservation within the family

What are the most significant challenges in working with recombinant uncharacterized proteins like F46C5.2, and how can they be addressed?

Major challenges and solutions when working with uncharacterized proteins include:

  • Optimal expression and purification:

    • Challenge: Obtaining correctly folded, soluble protein

    • Solution: Test multiple expression systems (bacterial, yeast, baculovirus, mammalian)

    • Solution: Optimize induction conditions (temperature, inducer concentration, duration)

    • Solution: Consider fusion partners to enhance solubility (MBP, SUMO, thioredoxin)

  • Structural determination:

    • Challenge: Lack of structural information hampers functional prediction

    • Solution: Employ bioinformatic prediction tools for secondary structure

    • Solution: Use circular dichroism to assess secondary structure content

    • Solution: Consider X-ray crystallography or NMR for detailed structural analysis

  • Functional annotation:

    • Challenge: No established assays for unknown function

    • Solution: Conduct unbiased screens for biochemical activities

    • Solution: Use pull-down assays to identify interaction partners

    • Solution: Perform metabolomic profiling to detect changes upon protein expression

  • Physiological relevance:

    • Challenge: Connecting biochemical activities to in vivo function

    • Solution: Generate tissue-specific rescue constructs in null background

    • Solution: Create reporter fusions to monitor protein localization and dynamics

    • Solution: Identify conditions that regulate protein expression or modification

Addressing these challenges requires an integrative approach combining biochemical, genetic, and computational methods to gradually build understanding of F46C5.2 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.