Recombinant Uncharacterized protein F54C8.6 (F54C8.6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
F54C8.6; Uncharacterized protein F54C8.6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
F54C8.6
Target Protein Sequence
MSGRYEVQNRYSAYIEARRNYLEQSESEEDIEVRTILRRPQIYSRRTVSTSSEEQPTTPA MVLVPTVTIQEAPKVVEIPTNGLPEPTPSSSVVQEIEILAPNEDEVKEEKPSDCTTCKKI ENFVMPYYESLKAKYQQFVVRISDPALHATIRSEFAEYFPSVLLGFAIFFFGITFISFIK LLRGVSTQPSFFCRYFSGPFSPLFDALCEPDPYVLSEELPKVMSGLLDEMFITISEFFQT ISKGFTVFGTLFTAIWHGLSENVFFGFHELGENLGENINHLLHFVVQFFHQIIHLILSSI ATIAGAIAGVFTSVHDYLEPPQNVW
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_F54C8.6

UniGene: Cel.10434

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Uncharacterized Protein F54C8.6?

Uncharacterized protein F54C8.6 (P34444) is a 325-amino acid protein derived from Caenorhabditis elegans. The full-length protein sequence contains distinct structural motifs and potential functional domains that remain to be fully characterized. Current recombinant versions typically feature an N-terminal His tag and are commonly expressed in E. coli expression systems . The protein's primary structure suggests potential membrane association, as indicated by hydrophobic regions that may form transmembrane domains within its sequence.

What expression systems are suitable for producing Recombinant F54C8.6?

E. coli represents the primary expression system currently utilized for producing recombinant F54C8.6 protein . When designing an expression strategy, researchers should consider the fundamental principles of experimental design, including clear variable definition and hypothesis formulation . The most efficient expression typically involves optimizing the following parameters:

ParameterConsiderations
Expression vectorpET series vectors commonly used with His-tag fusion
Host strainBL21(DE3) or Rosetta for potential rare codon usage
Induction conditionsIPTG concentration, temperature, and duration
Cell lysis methodSonication or chemical lysis depending on protein localization

Researchers should systematically test these variables to determine optimal expression conditions, following the established principles of experimental design by controlling extraneous variables .

How can I confirm the identity of purified F54C8.6 protein?

Identity confirmation typically follows a multi-method approach:

  • SDS-PAGE analysis to confirm molecular weight (approximately 36-38 kDa including the His tag)

  • Western blot analysis using anti-His antibodies

  • Mass spectrometry for peptide mass fingerprinting

  • N-terminal sequencing to confirm the presence of the His tag and initial amino acid sequence

Each validation method should be considered an independent variable in your experimental design, with the dependent variable being protein identity confirmation . This approach strengthens confidence in your findings through method triangulation.

What functional domains have been predicted in F54C8.6?

Sequence analysis of F54C8.6 reveals several notable features within its 325-amino acid sequence . Bioinformatic analysis indicates the presence of:

  • Transmembrane-like domains (hydrophobic regions): "GFAIFFFGITFISFIK" and similar sequences suggest membrane association

  • Potential phosphorylation sites: Multiple serine and threonine residues in regions like "SEEQPTTPA"

  • Conserved motifs: The sequence "YESLKAKYQQFVVR" shows conservation in related proteins

Researchers should design specific mutation studies targeting these regions to empirically determine their functional significance. Experimental designs should include systematic manipulation of these domains as independent variables while measuring functional outcomes as dependent variables .

How can I investigate potential binding partners of F54C8.6?

Investigation of protein-protein interactions requires a systematic research design approach . Consider the following methodological framework:

  • Pull-down assays: Using His-tagged F54C8.6 as bait with C. elegans lysate

  • Yeast two-hybrid screening: Constructing fusion proteins with F54C8.6 domains

  • Co-immunoprecipitation: If antibodies against F54C8.6 are available

  • Crosslinking studies: Using chemical crosslinkers followed by mass spectrometry

Data collection procedures must be carefully planned to ensure reliability and validity . For pull-down experiments, control for non-specific interactions by including negative controls using unrelated His-tagged proteins. Analyze results through both qualitative methods (identifying binding partners) and quantitative approaches (measuring binding affinities) .

What structural analysis techniques are most informative for F54C8.6?

Structural determination follows a progressive research design strategy, moving from lower to higher resolution techniques:

What controls are essential when working with F54C8.6?

Robust experimental design requires appropriate controls to ensure validity . Essential controls include:

  • Negative controls:

    • Empty vector expression in the same system

    • Unrelated His-tagged protein purified by the same method

    • Inactive mutant versions of F54C8.6

  • Positive controls:

    • Well-characterized proteins with known functions similar to predicted F54C8.6 functions

    • Related proteins from the same family if identified

  • Procedural controls:

    • Pre-immune serum for antibody experiments

    • Buffer-only controls for binding assays

Control selection should be guided by the specific hypothesis being tested, with careful consideration of potential confounding variables .

How can I design experiments to determine cellular localization of F54C8.6?

Localization studies require a multi-method research design :

  • Subcellular fractionation:

    • Separate cellular compartments biochemically

    • Analyze F54C8.6 distribution by immunoblotting

    • Include markers for each cellular compartment

  • Immunofluorescence microscopy:

    • Express tagged F54C8.6 in relevant cell types

    • Co-stain with organelle markers

    • Analyze colocalization quantitatively

  • Live cell imaging:

    • Create fluorescent protein fusions with F54C8.6

    • Monitor localization in real-time

    • Perform FRAP analysis for dynamics

How should I analyze contradictory results in F54C8.6 characterization studies?

When facing contradictory results, apply a systematic analytical approach:

  • Methodological assessment: Evaluate whether different methods might reveal different aspects of protein function

  • Condition-dependent effects: Investigate whether protein behavior changes under different experimental conditions

  • Artifact elimination: Rule out technical artifacts through additional controls and method validation

Your data analysis strategy should include both descriptive statistics (summarizing experimental outcomes) and inferential statistics (testing specific hypotheses about F54C8.6 function) . When contradictory results persist, consider designing experiments specifically to resolve the contradiction, treating the contradiction itself as the research question.

What statistical approaches are appropriate for analyzing F54C8.6 interaction data?

Statistical analysis of protein interaction data should match the experimental design :

  • For qualitative binding studies:

    • Frequency analysis of detected interactions

    • Enrichment calculations compared to background

  • For quantitative binding measurements:

    • Determination of binding constants (Kd, Ka)

    • Comparison of affinities across different conditions

  • For network analysis:

    • Clustering of interaction partners

    • Pathway enrichment analysis

The level of measurement for your variables will determine appropriate statistical tests . For comparing binding across conditions, t-tests or ANOVAs may be appropriate, while correlation analysis can reveal relationships between binding strength and functional outcomes.

How can I integrate multiple datasets to develop a functional model for F54C8.6?

Data integration requires a comprehensive research design approach :

  • Data harmonization: Ensure comparable scales and formats across datasets

  • Weighted integration: Consider reliability and relevance of different data sources

  • Iterative refinement: Update models as new data becomes available

Consider creating a data table similar to the format below to systematically track evidence supporting different functional hypotheses:

Functional HypothesisSupporting EvidenceContradicting EvidenceConfidence Level
Membrane transporterSequence motifs, localizationNo direct transport assaysMedium
Signaling componentPhosphorylation sites, interactionsNo pathway perturbation dataLow
Structural proteinExpression pattern, localizationNo structural defects in mutantsLow

This approach creates a framework for evaluating the strength of evidence for each potential function, highlighting areas where additional research is needed .

How can researchers build effective collaborative networks to study F54C8.6?

Building research partnerships to study uncharacterized proteins requires establishing trust among stakeholders. Effective collaborations prioritize:

  • Authentic communication between partners

  • Development of reciprocal relationships

  • Clear methodologies to resolve potential problems

Community members, healthcare providers, and academic researchers all rate "authentic communication" and "reciprocal relationships" as the most important factors for building trust . For researchers working with F54C8.6, this translates to open sharing of reagents, protocols, and preliminary data while establishing clear agreements about credit attribution and publication strategies.

What data sharing practices support collaborative F54C8.6 research?

Effective collaborative research requires standardized data formats that facilitate comparison across studies. When preparing institutional research training grant applications and progress reports, researchers should follow NIH guidelines for data tables . For F54C8.6 research specifically, consider:

  • Depositing full experimental datasets in appropriate repositories

  • Using consistent ontologies to describe experimental conditions

  • Providing detailed methodological supplements with publications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.