Recombinant Uncharacterized protein F54F2.9 (F54F2.9)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Uncharacterized protein F54F2.9 (F54F2.9) is a protein identified in the nematode Caenorhabditis elegans (C. elegans) . Characterized as a germline-expressed nucleic acid binding protein (GNBP), F54F2.9 contains a DNAJC1 domain . Studies suggest it plays a regulatory role in germ cell development .

3.1. Impact on Germline Development

Research shows that silencing F54F2.9 via RNAi leads to significant changes in the size of the proliferative zone (PZ) within the germline . RNAi silencing of F54F2.9 was conducted from the L1 stage, and germ cell number was then quantified in the PZ and TZ by DAPI staining . This suggests that F54F2.9 is a regulator of germline development .

3.2. Nucleic Acid Binding Properties

F54F2.9 is categorized as a nucleic acid-binding protein, suggesting its involvement in processes related to DNA or RNA . Further studies would be needed to elucidate the specific nucleic acid targets and the nature of these interactions.

Data Table: Effects of F54FSilencing on Germline Development

FeatureObservation
Experimental MethodRNAi silencing from the L1 stage.
Consequence≥20% change in PZ size when silenced .
Germline Regions AffectedSilencing of F54F2.9 caused distal phenotypes .
Proteins Interacted WithInteracts with proteins involved in translation, such as initiation factor IF-2 .

Role in Protein Interactions and Assemblies

F54F2.9 contains a DNAJC1 domain, indicating its potential involvement in protein interactions and folding processes . DNAJC1 proteins are known to function as chaperones, which assist other proteins in achieving their correct three-dimensional structure and prevent aggregation .

Potential Biomedical Applications

The Streptococcus pneumoniae protein Spr0479, which shares 40-51% identity (64-70% similarity) with orthologues from Gram-positive pathogens, including Clostridium difficile, E. faecium and S. aureus, is considered a promising target for rational drug design .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
F54F2.9; Uncharacterized protein F54F2.9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-414
Protein Length
Full Length of Mature Protein
Species
Caenorhabditis elegans
Target Names
F54F2.9
Target Protein Sequence
QWTSEDLALYDLVEEVGVNFYEWFDIPRDASSNQVKKAYRKLTLEWHPDRNSAPDATEKF RQVAGIYEVLKTTELREKYDNVLENGLPSWRHPMYYYRRMRKLAWYEGILVLLFIGTIAH YLMMWAAYFEKTLVYKQNVKKSRKSKKEDPAEAEKLMKQALEEYLPKYSELLPIILARGT VTLFKNLALTAKDAMTPKEVEPEEPTEEELAQQRRQQRAAAAPQQLEFKFEVAQGMKAVS TNDPEMEKKYAAENEVVAQKQSGATWTPDELASLVRLSTEKYPAGTPNRWEQMGRVLNRS AEDVIAMAGKMKQMKQEDYTKLLMTTIQQSVPVEEKSEDDWSQAEQKAFETALQKYPKGT DERWERISEEIGSKTKKQVMVRFKQLAEMIRKKKTNDT
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_F54F2.9

STRING: 6239.F54F2.9

UniGene: Cel.31303

Subcellular Location
Nucleus membrane; Single-pass membrane protein.

Q&A

What is Uncharacterized protein F54F2.9 and what organism does it originate from?

Uncharacterized protein F54F2.9 is a protein-coding gene product (gene ID: LOC110997404) derived from Pieris rapae, commonly known as the cabbage white butterfly . This protein is currently classified as "uncharacterized," indicating that its structure and function have not been fully elucidated through experimental methods. The corresponding mRNA (XM_022265551.1) and protein (XP_022121243.1) sequences have been identified and are available in the NCBI Reference Sequence Database . The lack of functional annotation presents both challenges and opportunities for researchers seeking to understand novel proteins and their potential roles in biological systems.

What expression systems are recommended for recombinant production of F54F2.9?

When expressing recombinant uncharacterized proteins like F54F2.9, mammalian expression systems such as HEK293 cells often provide advantages for maintaining protein folding and post-translational modifications. These systems can be established using standard vectors like pcDNA3.1, which is compatible with the ORF sequences of LOC110997404 . When selecting an expression system, the choice of selectable marker significantly impacts expression levels. Research has demonstrated that BleoR marker with zeocin selection yields approximately 10-fold higher recombinant protein expression compared to NeoR or BsdR markers . For intermediate but still high expression levels, PuroR- or HygR-based vectors with puromycin or hygromycin selection respectively are effective alternatives . This marker-dependent expression pattern has been observed across multiple cell lines, including HEK293 and COS7, suggesting a consistent biological phenomenon rather than a cell line-specific effect.

How can I optimize experimental design for characterizing an uncharacterized protein like F54F2.9?

Designing experiments for uncharacterized proteins requires a systematic approach focusing on identifying variables and controlling extraneous factors. Begin by clearly defining your independent variables (e.g., expression conditions, purification methods) and dependent variables (e.g., protein yield, activity measurements) . Formulate specific, testable hypotheses about potential functions based on sequence homology with characterized proteins. When designing experimental treatments, include appropriate positive and negative controls to establish baselines and ensure result validity . For F54F2.9 specifically, implementing a between-subjects design where different experimental conditions are tested independently allows for clearer comparisons of expression outcomes. Throughout the experimental process, measure your dependent variables consistently and precisely, using quantitative methods where possible to facilitate statistical analysis . This structured approach helps maintain experimental rigor when working with proteins of unknown function.

How does the choice of selectable marker affect the expression level and cell-to-cell variability of recombinant F54F2.9?

The selectable marker choice significantly impacts both expression levels and expression consistency across cell populations. Research has demonstrated that different marker/antibiotic combinations establish distinct selection thresholds that directly influence recombinant protein expression patterns . For F54F2.9 expression, BleoR marker with zeocin selection would likely produce approximately 10-fold higher expression levels compared to NeoR (G418) or BsdR (blasticidin) systems . Additionally, the BleoR/zeocin system demonstrates the lowest cell-to-cell variability in protein expression, creating more homogeneous production . This phenomenon extends beyond cellular expression to affect protein content in cell-derived exosomes, which has implications for downstream applications and analysis . The molecular mechanism behind these differences appears related to selection threshold stringency, where higher thresholds eliminate cells with lower expression levels, resulting in populations with uniformly high expression of the recombinant protein.

What bioinformatic approaches are most effective for predicting structure and function of uncharacterized proteins like F54F2.9?

Comprehensive in silico characterization of uncharacterized proteins should follow a multi-faceted approach. Initial analysis should include prophage identification using tools like PHASTER to determine if the protein has viral origins, and CRISPR-Cas system identification to evaluate potential roles in bacterial immunity . Subsequent analysis should assess human proteome similarity, where proteins with <35% identity to human proteins (which is likely the case for F54F2.9 from an insect species) are prioritized for further investigation . Virulence prediction is crucial for understanding potential pathogenic roles, though this may be less relevant for proteins from non-pathogenic organisms like Pieris rapae . Antigenicity analysis using platforms like VaxiJen can identify whether the protein possesses antigenic properties, which approximately 36-41% of uncharacterized proteins typically do . For F54F2.9 specifically, combining these approaches with structural prediction tools (e.g., AlphaFold) and comparative analysis with characterized proteins from related organisms would provide the most comprehensive functional insights.

What reporting guidelines should be followed when publishing characterization data for F54F2.9?

When publishing characterization data for novel proteins like F54F2.9, adherence to standardized reporting frameworks ensures reproducibility and comprehensive data presentation. For NIH-funded research, data tables should follow specific formatting requirements based on the type of research program . The tables should include comprehensive information about participating departments, faculty members, available research support, and relevant publications . For experimental procedures, clearly document all variables examined, the hypothesis being tested, experimental treatments employed, group assignment methods, and measurement approaches for dependent variables . All data should be presented with appropriate statistical analysis and clear differentiation between observed results and interpretations. When reporting sequence or structural data, submit to appropriate databases (e.g., NCBI, PDB) and include accession numbers in publications. Additionally, if computational prediction methods were employed, document all algorithms, parameters, and thresholds used to enable others to reproduce analyses and build upon findings.

How can contradictory results in F54F2.9 characterization experiments be reconciled and analyzed?

When facing contradictory results in protein characterization experiments, implement a systematic troubleshooting approach. First, examine experimental design elements that might contribute to inconsistencies, such as differences in expression systems, purification methods, or assay conditions . The choice of selectable marker can significantly impact expression levels and protein behavior; for instance, a BleoR/zeocin system may yield different results than NeoR/G418 due to 10-fold differences in expression levels . Create a detailed comparison table documenting all experimental variables across contradictory experiments:

Experimental FactorExperiment AExperiment BPotential Impact
Cell lineHEK293COS7Post-translational modifications
Selectable markerBleoR/zeocinNeoR/G41810-fold expression difference
Purification methodAffinitySize exclusionStructural integrity
Buffer conditionspH 7.4pH 6.8Activity/folding differences
Assay temperature25°C37°CEnzymatic activity rates

Next, design critical experiments that specifically test the variables most likely causing discrepancies. Consider whether cell-to-cell variability in expression might be confounding results, as some selection systems (NeoR/BsdR) demonstrate greater expression heterogeneity than others (BleoR) . Finally, evaluate whether contradictions might reflect actual biological complexity rather than experimental error—uncharacterized proteins often have context-dependent functions that manifest differently under varied conditions.

What purification strategies are most effective for recombinant F54F2.9 from expression systems?

Purifying recombinant F54F2.9 requires a tailored approach based on its physical and chemical properties. Begin by adding appropriate affinity tags (His6, FLAG, or GST) to the expression construct in vectors like pcDNA3.1 . The selection of tag should consider downstream applications and potential interference with protein function. For initial capture, immobilized metal affinity chromatography (IMAC) with a His6-tag offers efficient purification from complex cellular lysates. When designing the purification workflow, account for the expression system's impact on yield; BleoR/zeocin-selected cells typically provide approximately 10-fold higher protein levels than NeoR/G418 or BsdR/blasticidin systems . This higher expression starting point significantly improves purification efficiency and final yield.

Following initial capture, secondary purification steps should include either ion exchange chromatography or size exclusion chromatography to achieve higher purity. Throughout the purification process, optimize buffer conditions based on predicted protein properties from bioinformatic analysis. For quality control, implement multiple analytical methods:

Analytical MethodPurposeAcceptance Criteria
SDS-PAGEPurity assessment>95% purity by densitometry
Western blotIdentity confirmationSingle band at expected MW
Size exclusionAggregation analysis>90% monomeric species
Mass spectrometrySequence verification>95% sequence coverage
Dynamic light scatteringHomogeneity analysisPDI <0.2

This comprehensive purification and analysis approach ensures high-quality protein for subsequent functional and structural characterization experiments.

How can Google's People Also Ask data be leveraged to identify research trends and gaps in F54F2.9 studies?

Google's People Also Ask (PAA) feature provides valuable insights into research trends and knowledge gaps by revealing common questions researchers are asking. PAAs appear in over 80% of English searches and can cascade to reveal related questions when clicked . To leverage this resource for F54F2.9 research, begin by systematically collecting PAA questions from relevant scientific search queries. Track these questions over time, as checking back regularly helps identify emerging research directions and when content updates are needed .

Analyze the collected PAA data to identify patterns in research interests using the following approach:

  • Categorize questions by research theme (e.g., structure prediction, functional analysis, expression optimization)

  • Identify knowledge gaps where questions lack comprehensive answers

  • Map question complexity to understand the distribution of basic versus advanced research interests

  • Monitor question evolution over time to detect shifting research priorities

The insights gained can inform your research planning by highlighting understudied aspects of F54F2.9 that may yield high-impact publications. Additionally, understanding common questions helps structure your research manuscripts to address the scientific community's most pressing interests, potentially increasing citation rates and research impact. When PAA data reveals methodological questions without satisfactory answers, this indicates opportunities for method development or optimization papers that could become highly cited resources in the field.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.