Recombinant Uncharacterized protein F59B10.6 (F59B10.6)

Shipped with Ice Packs
In Stock

Description

Production and Formulation

Key Parameters

ParameterDetails
Expression VectorCustom vectors for recombinant expression
PurificationAffinity chromatography (His-Tag)
BufferTris/PBS-based, 6% trehalose
Storage-20°C or -80°C (avoid freeze-thaw)

Quality Control

  • Purity confirmed via SDS-PAGE

  • Sequence identity validated through mass spectrometry or N-terminal sequencing

Research Applications

Current Uses

  1. Vaccine Development

    • Serves as a potential antigen in vaccine research due to its immunogenic properties .

  2. Genetic Studies

    • Investigates gene-phenotype correlations in C. elegans, particularly for sterility (Ste) and uncoordinated (Unc) phenotypes .

  3. Biochemical Assays

    • ELISA kits for detection/quantification (e.g., CSB-CF600293CXY) .

Pathway Involvement
While F59B10.6 is implicated in undefined pathways, related proteins in C. elegans are linked to:

  • Developmental signaling: EGF, MAPK, and NOTCH pathways .

  • Cell differentiation: Vulval precursor cell (VPC) specification .

Research Findings and Gaps

Bioinformatics Insights

  • TBLASTx analyses suggest homology with uncharacterized proteins in other species .

  • RNAi screens in C. elegans have not directly implicated F59B10.6 in Ste/Unc phenotypes .

Functional Ambiguity

  • No direct evidence links F59B10.6 to specific biological processes.

  • Potential roles inferred from sequence similarity to membrane-associated proteins (e.g., F59B10.6’s hydrophobic regions suggest transmembrane domains) .

Future Directions

  1. Functional Characterization

    • Knockout/knock-in studies to elucidate in vivo roles.

  2. Interaction Mapping

    • Co-IP or yeast two-hybrid assays to identify binding partners.

  3. Therapeutic Potential

    • Exploration in neurodegenerative diseases or developmental disorders, leveraging C. elegans as a model.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
F59B10.6; Uncharacterized protein F59B10.6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
F59B10.6
Target Protein Sequence
MHLEVTEKHVNMESYKPAIDLLFDEVSQIFWIVLFFYVIVSMIWIMYCCYINKMELSLVE KKIEENGVARSKELQRLLDAYNKITAENPTAPNPQSSSIIIPEQV
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_F59B10.6

UniGene: Cel.5932

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is F59B10.6 and how is it classified?

F59B10.6 is an uncharacterized protein in C. elegans that shows similarity to Drosophila melanogaster neu3 metallopeptidase . It appears in genomic studies related to lifespan regulation in response to reproductive signals. As a predicted metallopeptidase, it likely belongs to the hydrolase family of enzymes that catalyze the cleavage of peptide bonds using metal ions as cofactors. Proper characterization requires sequence analysis, structural prediction, and experimental validation through recombinant protein expression and enzymatic assays.

What experimental approaches are recommended for initial characterization of F59B10.6?

Initial characterization should employ a multi-faceted approach:

  • Sequence analysis: Compare F59B10.6 with characterized proteins using BLAST and multiple sequence alignments to identify conserved domains and motifs.

  • Expression pattern analysis: Generate transgenic worms expressing F59B10.6::GFP fusion proteins to determine temporal and spatial expression patterns.

  • RNAi knockdown: Use RNA interference to assess loss-of-function phenotypes.

  • Recombinant protein production: Express the protein in bacterial or yeast systems for biochemical and structural studies.

  • Basic enzymatic assays: Test for metallopeptidase activity using standard substrates if the sequence analysis supports this predicted function.

How can researchers generate reliable recombinant F59B10.6 protein for in vitro studies?

Producing recombinant F59B10.6 involves several critical steps:

  • Codon optimization: Adjust codons for the expression system (E. coli, yeast, or insect cells).

  • Vector selection: Choose expression vectors with appropriate promoters and fusion tags (His, GST, or MBP) to enhance solubility and facilitate purification.

  • Expression conditions optimization: Test multiple temperatures (16°C, 25°C, 37°C), induction conditions (IPTG concentration), and expression durations.

  • Purification strategy: Implement a two-step purification process combining affinity chromatography with size exclusion or ion exchange chromatography.

  • Protein quality assessment: Verify purity by SDS-PAGE and confirm proper folding through circular dichroism or limited proteolysis.

This methodical approach maximizes the likelihood of obtaining functional protein for downstream applications.

What methods can determine the spatiotemporal expression pattern of F59B10.6 in C. elegans?

Determining expression patterns requires complementary approaches:

  • Transcriptional reporter constructs: Create F59B10.6 promoter::GFP constructs to visualize transcriptional activity.

  • Translational fusion reporters: Generate full-length F59B10.6::GFP fusions to track protein localization.

  • Developmental time-course analysis: Examine expression at different life stages (embryo, L1-L4 larvae, adult).

  • Tissue-specific RT-qPCR: Extract RNA from isolated tissues using microfluidic or laser-capture methods for quantitative expression analysis.

  • Single-cell RNA sequencing: Apply scRNA-seq to define cell-type specific expression patterns.

These methods collectively provide a comprehensive understanding of when and where F59B10.6 functions.

How does F59B10.6 expression change in germline-deficient animals with extended lifespan?

Based on available studies on germline-mediated longevity in C. elegans, researchers should investigate F59B10.6 expression using:

  • Comparative microarray analysis: Analyze expression in wild-type versus germline-deficient animals (e.g., glp-1 mutants) .

  • RT-qPCR validation: Quantify expression changes under different conditions.

  • Reporter strain analysis: Observe F59B10.6::GFP in intact versus germline-ablated animals.

  • Western blot: Measure protein levels with specific antibodies.

Preliminary data suggests that F59B10.6 may be regulated in response to reproductive signals that influence lifespan, though direct experimental confirmation is needed .

What transcription factors might regulate F59B10.6 expression?

F59B10.6 may be regulated by transcription factors involved in longevity pathways:

  • Promoter sequence analysis: Examine the upstream region for binding motifs of DAF-16/FOXO and DAF-12, two transcription factors known to mediate lifespan extension in germline-deficient animals .

  • ChIP-seq analysis: Perform chromatin immunoprecipitation to identify direct binding of transcription factors.

  • Reporter gene assays: Test promoter activity with mutated binding sites.

  • Expression analysis in transcription factor mutants: Measure F59B10.6 levels in daf-16 or daf-12 mutants.

The sequence TTATCAC has been identified as part of a putative ELT/DAF-16 binding site and may be relevant to F59B10.6 regulation .

What experimental designs are most appropriate for determining F59B10.6 function in vivo?

Several experimental designs can effectively characterize F59B10.6 function:

  • Completely Randomized Design: Suitable for initial screening experiments with controlled laboratory conditions to minimize variability .

  • Randomized Block Design: Appropriate when testing F59B10.6 function across different genetic backgrounds or environmental conditions with potential block effects .

  • Split Plot Design: Valuable when testing multiple factors that may influence F59B10.6 function with different experimental unit sizes .

  • Augmented Design: For screening large numbers of genetic interactions with F59B10.6 using limited resources; includes replicated standard/check varieties among non-replicated test varieties .

For RNAi screens targeting F59B10.6, researchers should include proper controls and sufficient biological replicates to ensure statistical power.

How can researchers determine if F59B10.6 affects lifespan in C. elegans?

To assess F59B10.6's effect on lifespan:

  • RNAi lifespan assays: Use bacterial feeding RNAi to knock down F59B10.6 in wild-type and germline-deficient backgrounds (e.g., glp-1) .

  • CRISPR/Cas9 knockout: Generate null mutations and assess lifespan.

  • Overexpression studies: Create transgenic lines with extra copies of F59B10.6.

  • Tissue-specific manipulation: Use tissue-specific promoters to determine where F59B10.6 functions.

  • Epistasis analysis: Test interactions with known longevity pathways (insulin/IGF-1, germline, dietary restriction).

Track survival using Kaplan-Meier analysis with log-rank statistics to determine significance. Ensure consistent temperature, food quality, and avoid contamination.

How to investigate potential metallopeptidase activity of F59B10.6?

To characterize the predicted metallopeptidase activity:

  • Substrate profiling: Test purified recombinant F59B10.6 against various peptide substrates.

  • Metal dependency analysis: Assess activity with different metal ions (Zn²⁺, Mn²⁺, Co²⁺, etc.) and chelating agents (EDTA).

  • Site-directed mutagenesis: Mutate predicted catalytic residues to confirm their importance.

  • Inhibitor studies: Test sensitivity to various metalloprotease inhibitors.

  • In vivo substrate identification: Use techniques like TAILS (Terminal Amine Isotopic Labeling of Substrates) to identify physiological substrates.

Results should be quantified using appropriate enzymatic assays and validated through multiple independent experiments.

What methods are recommended for structural characterization of F59B10.6?

For structural analysis of F59B10.6:

  • X-ray crystallography: Express, purify, and crystallize the protein for high-resolution structural determination.

  • Cryo-electron microscopy: Suitable for larger protein complexes or proteins resistant to crystallization.

  • NMR spectroscopy: For dynamic analysis of smaller domains or the full protein if size permits.

  • Small-angle X-ray scattering (SAXS): For low-resolution shape determination in solution.

  • In silico structural prediction: Use AlphaFold2 or RoseTTAFold for initial structural models.

These approaches can be complementary, with computational predictions guiding experimental design and experimental data validating or refining models.

How can researchers identify functional domains in F59B10.6?

Identifying functional domains requires combining computational and experimental approaches:

  • Domain prediction software: Use tools like SMART, Pfam, and InterPro to identify conserved domains.

  • Truncation analysis: Create series of truncated proteins to map functional regions.

  • Limited proteolysis: Identify stable domains resistant to proteolytic digestion.

  • Homology modeling: Model domains based on structurally characterized homologs.

  • Functional complementation: Test domain functionality through rescue experiments.

For metallopeptidases, focus on identifying the catalytic motif (often HEXXH in zinc-dependent metallopeptidases) and substrate-binding regions.

What techniques can identify protein interaction partners of F59B10.6?

Multiple complementary approaches should be used:

  • Yeast two-hybrid screening: Identify binary interactions using F59B10.6 as bait.

  • Co-immunoprecipitation: Pull down F59B10.6 complexes from C. elegans lysates.

  • Proximity labeling: Use BioID or APEX2 fusions to label proximal proteins in vivo.

  • Mass spectrometry: Identify components of purified complexes.

  • Split-GFP complementation: Visualize interactions in live animals.

Based on data from similar pathways, potential interacting partners might include components of the DAF-16 and DAF-12 signaling networks, such as FTT-2 (a 14-3-3 protein) which has been shown to interact with lifespan-regulating factors .

How to determine if F59B10.6 interacts with the DAF-16/FOXO pathway?

To investigate potential interactions with the DAF-16 pathway:

  • Epistasis analysis: Compare lifespan effects of F59B10.6 knockdown in wild-type versus daf-16 mutant backgrounds.

  • Reporter gene analysis: Assess if F59B10.6 knockdown affects expression of DAF-16 target genes like dod-8 and sod-3 .

  • Co-immunoprecipitation: Test for physical interaction between F59B10.6 and DAF-16 or known DAF-16 regulators.

  • Subcellular localization: Determine if F59B10.6 knockdown affects DAF-16 nuclear translocation.

  • ChIP analysis: Check if DAF-16 binds to the F59B10.6 promoter.

Similar approaches can be applied to test interactions with PHI-62 and FTT-2, which have been implicated in DAF-16-dependent transcription in germline-deficient animals .

How should researchers analyze microarray data to identify pathways associated with F59B10.6?

For comprehensive pathway analysis:

  • Differential expression analysis: Compare expression profiles between experimental conditions using appropriate statistical methods.

  • Gene Ontology enrichment: Identify enriched biological processes, molecular functions, and cellular components.

  • Pathway analysis: Use KEGG, Reactome, or WormBase pathways to contextualize findings.

  • Network analysis: Construct interaction networks to identify functional modules.

  • Integration with public datasets: Compare with published data on longevity pathways.

When analyzing microarray data related to F59B10.6, researchers should employ a block design for experiments to control for batch effects and technical variables .

What statistical approaches are recommended for lifespan data analysis involving F59B10.6?

Lifespan data should be analyzed using:

  • Kaplan-Meier survival analysis: Generate survival curves for different experimental groups.

  • Log-rank test: Compare survival distributions between groups.

  • Cox proportional hazards model: Include covariates that might affect lifespan.

  • Multiple comparisons correction: Apply methods like Bonferroni or Benjamini-Hochberg when testing multiple hypotheses.

  • Power analysis: Ensure sufficient sample sizes to detect biologically meaningful differences.

Each lifespan experiment should include at least 80-100 animals per condition and be repeated independently at least three times to ensure reproducibility.

How can researchers integrate multi-omics data to understand F59B10.6 function comprehensively?

For multi-omics integration:

  • Data harmonization: Normalize and standardize data from different platforms.

  • Correlation analysis: Identify relationships between transcriptomic, proteomic, and metabolomic changes.

  • Pathway-level integration: Map changes to common pathways across omics layers.

  • Machine learning approaches: Apply supervised and unsupervised methods to identify patterns.

  • Visualization tools: Use dimension reduction techniques and interactive visualizations to explore complex relationships.

Table 1: Example data integration framework for F59B10.6 functional characterization

Data TypeTechniquePrimary AnalysisIntegration MethodExpected Insight
TranscriptomicsRNA-seq, MicroarrayDifferential expressionEnrichment analysisGene regulatory networks
ProteomicsMass spectrometryProtein abundance changesCorrelation with transcriptsPost-transcriptional regulation
MetabolomicsLC-MS/MSMetabolite profilingPathway mappingBiochemical consequences
PhenomicsLifespan assays, Stress testsSurvival analysisPhenotype-molecular correlationPhysiological outcomes
InteractomicsCo-IP, Y2HInteraction mappingNetwork analysisFunctional protein complexes

How can researchers optimize RNAi experiments targeting F59B10.6?

For effective RNAi targeting F59B10.6:

  • Construct design: Design dsRNA sequences with high specificity (verify using BLAST to avoid off-targets).

  • Delivery method optimization: Compare feeding, soaking, and injection methods for knockdown efficiency.

  • Tissue-specific RNAi: Use tissue-specific RNAi-sensitive strains to determine where F59B10.6 functions.

  • Timing optimization: Apply RNAi at different developmental stages to avoid developmental effects.

  • Quantification of knockdown: Verify knockdown efficiency using RT-qPCR or western blotting.

Include appropriate controls (empty vector, non-targeting sequence) and validate phenotypes using genetic mutants when possible.

What energy and resource considerations should researchers account for when designing long-term F59B10.6 experiments?

For sustainable long-term experiments:

  • Energy efficiency: Optimize incubator and equipment usage to minimize energy consumption while maintaining experimental conditions .

  • Resource management: Calculate reagent requirements in advance to reduce waste .

  • Experimental design optimization: Use statistical power calculations to determine minimum sample sizes needed.

  • Laboratory workflow planning: Coordinate experiments to maximize resource sharing and minimize redundancy.

  • Data storage and analysis planning: Implement efficient data management systems.

Table 2: Energy consumption considerations for long-term protein studies

Equipment TypeEnergy Usage (GJ/Year)Optimization StrategyPotential Reduction (%)
Incubators10-15Temperature cycling, shared usage15-20
Freezers (-80°C)20-25Sample consolidation, regular maintenance10-15
Computing resources5-8Cloud computing, scheduled analysis20-30
Centrifuges3-5Full loads, scheduled runs15-20

Based on typical laboratory energy intensity of 10.75 GJ/Metric Ton of production .

How can researchers address potential experimental variability in F59B10.6 function across different C. elegans strains?

To manage strain variability:

  • Strain standardization: Maintain consistent genetic backgrounds and back-cross strains regularly.

  • Environmental control: Standardize culture conditions, temperature, and food quality.

  • Block experimental design: Group experiments by strain and randomize within blocks .

  • Mixed-effects statistical modeling: Account for strain as a random effect in analysis.

  • Validation across strains: Test key findings in multiple genetic backgrounds.

When using engineered strains, validate transgene copy number and integration sites to ensure consistent expression levels across experimental replicates.

How might understanding F59B10.6 contribute to aging research beyond C. elegans?

Translational implications include:

  • Evolutionary conservation analysis: Identify human homologs of F59B10.6 through phylogenetic studies.

  • Comparative biology: Test if homologs play similar roles in mammals using mouse models or cell culture.

  • Signaling pathway conservation: Determine if the pathway involving F59B10.6 is conserved in higher organisms.

  • Drug target potential: Assess if targeting homologs might influence aging-related processes in mammals.

  • Biomarker development: Evaluate if expression patterns of F59B10.6 homologs correlate with aging phenotypes.

Research suggests that reproductive signals impact lifespan across species, and understanding conserved factors like F59B10.6 could reveal fundamental aging mechanisms .

What emerging technologies might accelerate characterization of F59B10.6 function?

Cutting-edge approaches include:

  • CRISPR base editing: Make precise amino acid substitutions without double-strand breaks.

  • Optogenetics: Control F59B10.6 activity with light to study temporal aspects of function.

  • Nanopore sequencing: Detect RNA modifications that might regulate F59B10.6 expression.

  • Single-molecule imaging: Track F59B10.6 dynamics in living cells.

  • Protein structure prediction: Use AI tools like AlphaFold2 to model structures.

  • Spatial transcriptomics: Map expression with subcellular resolution.

These technologies can overcome traditional limitations in studying low-abundance or conditionally expressed proteins like F59B10.6.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.