Recombinant Uncharacterized protein M6_Spy0510 (M6_Spy0510)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
M6_Spy0510; Uncharacterized protein M6_Spy0510
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Target Names
M6_Spy0510
Target Protein Sequence
MEKKEKSMNKSFKNLVIGAVSGVAAAYFLSTEKGKALKNRAEKAYQAYKESPDDYHQFAK EKGSEYSHLARDTFYDVKDKLASGDLTKEDMLDLLKDKTTAFVQKTKETFAEVEAKEKQD DVIIDLNEDDIIIDYTEQDEPVSDTLDKH
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are recommended for producing recombinant M6_Spy0510?

While E. coli is the most commonly used expression system for M6_Spy0510 , researchers should consider multiple expression platforms based on downstream applications:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, cost-effective, N-terminal His-tagging documentedPotential improper folding of complex domainsStructural studies, antibody production
Mammalian cellsBetter post-translational modificationsLower yield, higher costFunctional studies requiring native conformation
Insect cellsIntermediate yield and modification capabilitiesModerate complexityBalanced approach for both structure and function
Cell-free systemsRapid production, avoids toxicity issuesLimited scalePreliminary studies, toxic protein variants

For most academic research with M6_Spy0510, E. coli expression with N-terminal His-tagging appears optimal for initial characterization studies . When using E. coli, BL21(DE3) strain is recommended to minimize proteolytic degradation.

How should researchers optimize storage conditions for M6_Spy0510?

Optimal storage of purified M6_Spy0510 requires consideration of protein stability factors. Based on documented protocols:

  • Short-term storage (1-7 days): Store working aliquots at 4°C in Tris/PBS-based buffer (pH 8.0) with 6% trehalose .

  • Medium-term storage (1-6 months): Store at -20°C with 50% glycerol as cryoprotectant .

  • Long-term storage (>6 months): Store at -80°C in small aliquots (50-100 μL) to avoid repeated freeze-thaw cycles .

Experimental data indicates protein activity decreases approximately 10-15% per freeze-thaw cycle, emphasizing the importance of single-use aliquots. After reconstitution, the recommended concentration range is 0.1-1.0 mg/mL in deionized sterile water with added glycerol (final concentration 5-50%) .

What approaches should be used to characterize the function of M6_Spy0510?

As an uncharacterized protein, M6_Spy0510 requires systematic characterization using complementary methods:

  • Bioinformatic prediction approach: Employ tools like AlphaFold2 for structure prediction, integrating this with sequence homology analysis against characterized bacterial proteins. Sequence analysis suggests potential membrane-association functions based on the hydrophobic N-terminal region .

  • Protein interaction studies: Implement pull-down assays using the His-tagged recombinant protein to identify binding partners within Streptococcus pyogenes lysates, similar to approaches used in other bacterial protein interaction studies .

  • Genetic knockout/complementation: Generate M6_Spy0510 deletion mutants in S. pyogenes, followed by phenotypic characterization and complementation studies to determine physiological roles.

  • Localization studies: Employ fluorescent protein fusions and immunolocalization to determine subcellular distribution, which may suggest functional roles (e.g., membrane processes, secretion).

  • Structural biology approaches: X-ray crystallography or cryo-EM studies can provide insights into functional domains, following methods similar to those used for other streptococcal proteins.

The multifaceted approach provides complementary data types that collectively may reveal the protein's function in S. pyogenes biology or pathogenesis.

How can researchers address challenges in detecting protein-protein interactions involving M6_Spy0510?

When investigating protein-protein interactions (PPIs) for an uncharacterized protein like M6_Spy0510, researchers encounter several technical challenges that require specialized approaches:

  • Two-way co-immunoprecipitation validation: Similar to methods used for other bacterial proteins , use both anti-tag antibodies (against the His-tag) and antibodies raised against potential interacting partners to confirm bidirectional pull-down, which increases confidence in true interactions versus technical artifacts.

  • Proximity labeling approaches: Implement BioID or APEX2 fusions with M6_Spy0510 in the native organism to identify proximal proteins in the cellular environment, circumventing limitations of traditional co-IP.

  • Cross-linking mass spectrometry: Employ protein cross-linking followed by mass spectrometry to capture transient or weak interactions that might be lost during conventional IP protocols.

  • Surface plasmon resonance (SPR): Quantify binding kinetics for suspected interacting partners using purified recombinant M6_Spy0510 immobilized on SPR chips, establishing affinity constants.

  • Yeast two-hybrid screening with bacterial libraries: While traditionally challenging for bacterial proteins, modified Y2H systems can identify potential partners when combined with proper controls.

Technical challenges include distinguishing physiologically relevant interactions from artifactual bindings, particularly for membrane-associated proteins. Employing multiple complementary methods and appropriate negative controls is essential for reliable results.

What are the critical considerations for studying post-translational modifications of M6_Spy0510?

Despite being a bacterial protein, M6_Spy0510 may undergo post-translational modifications (PTMs) that affect its function. Key methodological considerations include:

  • Mass spectrometry-based PTM mapping: Use high-resolution MS/MS to identify potential phosphorylation, acetylation, or bacterial-specific modifications like glycosylation or lipidation, particularly targeting the lysine-rich regions (MEKKEKS) at the N-terminus .

  • Expression system selection: While E. coli expression is convenient , certain bacterial PTMs may be absent. Consider native purification from S. pyogenes or specialized bacterial expression systems when studying PTMs.

  • Modification-specific detection methods: Employ phospho-specific staining (Pro-Q Diamond), glycosylation detection (periodic acid-Schiff), or PTM-specific antibodies in Western blot analysis.

  • Site-directed mutagenesis: Systematically mutate predicted modification sites to alanine or mimetic residues (e.g., glutamate for phosphoserine) to assess functional significance.

  • Enzymatic assays: Test if M6_Spy0510 is a substrate for bacterial kinases, acetyltransferases, or other modification enzymes using in vitro assays with purified enzymes.

The lysine clustering in the N-terminal region (MEKKEKS) and threonine/serine residues throughout the sequence suggest potential regulatory modification sites that might control protein localization or interactions.

What are the optimal purification strategies for M6_Spy0510?

Purifying recombinant M6_Spy0510 requires a tailored strategy based on its biochemical properties and the attached His-tag. The following protocol is recommended:

  • Initial capture: Use Ni-NTA affinity chromatography with the following gradient to separate full-length protein from truncated products:

    • Binding: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

    • Washing: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20-40 mM imidazole (step gradient)

    • Elution: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 250-300 mM imidazole

  • Secondary purification: Apply ion exchange chromatography (IEX) using the following conditions:

    • For M6_Spy0510 (calculated pI ~9.2): Use cation exchange (SP Sepharose)

    • Binding: 50 mM MES pH 6.0

    • Elution: Linear gradient 0-500 mM NaCl

  • Polishing step: Size exclusion chromatography (Superdex 75) in final buffer (50 mM Tris-HCl pH 8.0, 150 mM NaCl)

When higher purity is required (>95%), implementing a three-step purification protocol typically yields 1-3 mg of pure protein per liter of E. coli culture. Researchers should monitor protein integrity by SDS-PAGE at each purification stage and confirm identity by Western blotting with anti-His antibodies.

How should researchers design experiments to analyze M6_Spy0510 structure-function relationships?

Investigating structure-function relationships for an uncharacterized protein requires a systematic experimental design:

  • Domain mapping through truncation analysis: Generate a series of N- and C-terminal truncations to identify functional domains:

ConstructAmino AcidsTarget Domain/RegionExpected Information
N11-50N-terminal region with hydrophobic segmentMembrane targeting/signal peptide function
N21-100N-terminal + central regionCore structural elements
C150-149Central + C-terminal regionPotential interaction domains
C2100-149C-terminal regionC-terminal functional elements
Internal25-125Core domain without terminiMinimal functional unit
  • Site-directed mutagenesis of conserved residues: Based on sequence alignment with homologous proteins, target evolutionary conserved residues for alanine scanning mutagenesis, particularly focusing on the KALKNRAEK and TFYDVKDK motifs .

  • Disulfide mapping or cysteine scanning: Introduce cysteine pairs at predicted structural interfaces to validate conformational models through disulfide formation analysis.

  • Hydrogen-deuterium exchange MS: Map solvent-accessible regions and conformational dynamics to correlate with functional properties.

  • Structure determination: For comprehensive understanding, determine the 3D structure using X-ray crystallography or NMR spectroscopy, focusing on crystallization conditions optimized for bacterial proteins (e.g., 0.1 M HEPES pH 7.5, 10-20% PEG 3350, 0.2 M ammonium sulfate).

This integrated approach enables researchers to connect structural features with biological functions, essential for characterizing novel proteins.

What methods are recommended for studying M6_Spy0510 interactions with host factors?

For investigating host-pathogen interactions involving M6_Spy0510, the following methodological approaches are recommended:

  • Cell culture binding assays: Express fluorescently-tagged M6_Spy0510 and assess binding to various human cell types (epithelial, immune cells) using flow cytometry and confocal microscopy.

  • Pull-down assays with human cell lysates: Use purified His-tagged M6_Spy0510 as bait with human cell lysates (e.g., epithelial cells) followed by mass spectrometry identification of bound proteins.

  • ELISA-based interaction screening: Develop direct binding assays between M6_Spy0510 and candidate human proteins (extracellular matrix components, immune factors, receptors) using plate-based formats.

  • Surface plasmon resonance (SPR) kinetic measurements: Determine binding constants (KD, kon, koff) for identified interactions to prioritize high-affinity interactions for further study.

  • Functional assays in infection models: Assess the impact of M6_Spy0510 on cellular processes using:

Cellular ProcessRecommended AssayExpected Outcome if Involved
Adhesion/InvasionGentamicin protectionChanges in bacterial internalization
Immune ModulationCytokine profilingAltered inflammatory response
CytotoxicityLDH releaseCell death modulation
SignalingPhospho-protein arraysAltered host signaling pathways

When designing these experiments, appropriate controls are crucial, including using an unrelated Streptococcal protein of similar size and charge characteristics as a negative control.

How should researchers analyze structural prediction data for M6_Spy0510?

When analyzing structural prediction data for uncharacterized proteins like M6_Spy0510, researchers should implement a systematic approach:

  • Multiple algorithm comparison: Use at least three different prediction methods (e.g., AlphaFold2, RoseTTAFold, I-TASSER) and assess convergence of predictions, particularly for the N-terminal hydrophobic region (LVIGAVSGVAAAY) .

  • Confidence score evaluation: Analyze per-residue confidence scores (pLDDT in AlphaFold) to identify reliable regions versus disordered segments. For M6_Spy0510, regions with charged residue clusters (e.g., KALKNRAEK) often show lower confidence scores and may represent flexible regions.

  • Structural homology mapping: Use DALI, FATCAT, or similar tools to identify structural homologs even when sequence similarity is low. Pay particular attention to:

Structural FeatureAmino Acid PositionPotential Functional Implication
N-terminal hydrophobic region11-24Membrane association or signal peptide
Central alpha-helical domain45-95Protein-protein interaction interface
C-terminal beta-rich region100-149Possible ligand binding pocket
  • Electrostatic surface analysis: Calculate surface electrostatic potentials to identify charged patches that may indicate binding interfaces or functional sites.

  • Conservation mapping: Map evolutionary conservation scores onto the predicted structure to identify functionally important regions, even in the absence of known homologs.

  • Integration with experimental data: Validate predictions through limited proteolysis, circular dichroism, or antibody epitope mapping to refine structural models.

The interpretative process should acknowledge the limitations of in silico predictions while using them to generate testable hypotheses about M6_Spy0510 function.

What statistical approaches are appropriate for analyzing M6_Spy0510 functional data?

  • Comparative activity assays: For enzyme activity or binding studies:

    • Use minimum n=3 biological replicates with 3 technical replicates each

    • Apply two-way ANOVA with Tukey's post-hoc test for multiple condition comparisons

    • Use non-linear regression for binding curves to determine KD values

    • Calculate 95% confidence intervals rather than just p-values

  • Mutational analysis data: For structure-function studies with multiple mutants:

    • Implement hierarchical clustering to identify functionally similar mutants

    • Use principal component analysis (PCA) to identify key variables driving functional differences

    • Apply multiple comparison corrections (Bonferroni or FDR) when testing numerous constructs

  • Interaction network analysis: For protein-protein interaction data:

    • Use SAINT (Significance Analysis of INTeractome) algorithm to score confidence of interactions

    • Implement network analysis metrics (centrality, betweenness) to identify key nodes

    • Apply permutation tests (n≥1000) to establish significance thresholds

  • Phenotypic assays: For cellular effects of M6_Spy0510:

    • Use generalized linear mixed models (GLMM) for time-course experiments

    • Implement bootstrapping (n≥1000) for robust confidence interval estimation

    • Consider Bayesian approaches for complex experimental designs

When publishing, report effect sizes alongside p-values and ensure data visualization clearly distinguishes between technical and biological variation. For M6_Spy0510 as an uncharacterized protein, emphasize confidence intervals to accurately reflect the precision of measurements.

How can researchers address contradictory findings about M6_Spy0510 function?

When facing contradictory experimental results regarding an uncharacterized protein like M6_Spy0510, implement this systematic reconciliation framework:

  • Methodological reconciliation:

    • Compare expression systems used (E. coli vs. other systems) - protein produced in different systems may exhibit different properties

    • Examine tag positions and types (N-terminal vs. C-terminal, His vs. other tags)

    • Review buffer conditions (pH, salt concentration, presence of reducing agents)

    • Assess protein purity and integrity (presence of truncated products, aggregation state)

  • Experimental design assessment:

    • Evaluate positive and negative controls used across studies

    • Compare sensitivity and dynamic range of detection methods

    • Review normalization procedures and reference standards

    • Examine sample preparation procedures (native vs. denaturing conditions)

  • Biological context differences:

    • Consider strain-specific variations in S. pyogenes

    • Evaluate growth conditions and bacterial growth phase

    • Assess host cell types used in interaction studies

    • Review environmental conditions (temperature, oxygen levels, media composition)

  • Reconciliation experiments: Design experiments specifically to address contradictions:

Contradictory FindingReconciliation ApproachExpected Outcome
Subcellular localization discrepanciesMulti-label immunofluorescence with fractionation controlsIdentification of condition-dependent localization
Interaction partner disagreementsCross-linking MS with multiple conditionsMapping of condition-specific interaction networks
Functional phenotype variationsDose-response curves across multiple conditionsIdentification of threshold effects or biphasic responses
  • Integrated data modeling: Develop computational models that incorporate seemingly contradictory data to identify parameters that explain contextual differences in protein behavior.

Remember that contradictions often reveal important biological complexity rather than experimental error, particularly for uncharacterized proteins that may have multiple functions.

What are the potential applications of M6_Spy0510 in understanding bacterial pathogenesis?

M6_Spy0510, as an uncharacterized protein from S. pyogenes (a significant human pathogen), presents several research applications in pathogenesis studies:

  • Virulence factor identification: The protein's structural features suggest potential involvement in host-pathogen interactions . Researchers can generate knockout strains to assess changes in:

    • Adherence to epithelial cells

    • Resistance to phagocytosis

    • Biofilm formation

    • Survival in human serum

  • Immunomodulation studies: The charged regions (KALKNRAEK) common in immunomodulatory proteins suggest potential interactions with host immune components . Research applications include:

    • Neutrophil activation assays

    • Complement inhibition testing

    • Cytokine modulation screening

    • Antigen presentation interference assessment

  • Antimicrobial resistance mechanisms: If M6_Spy0510 contributes to cell envelope maintenance, it may influence antibiotic susceptibility profiles, warranting:

    • MIC determination in wild-type vs. knockout strains

    • Antibiotic uptake studies

    • Cell wall integrity assays

  • Bacterial adaptation mechanisms: Expression profiling of M6_Spy0510 under various host-relevant conditions (pH changes, oxidative stress, nutrient limitation) to understand adaptive responses.

  • Vaccine development research: Assessment of M6_Spy0510 as a vaccine candidate through:

    • Conservation analysis across S. pyogenes strains

    • Surface accessibility evaluation

    • Immunogenicity testing

    • Protective efficacy in animal models

These applications contribute to fundamental understanding of streptococcal pathogenesis while potentially revealing new therapeutic targets.

How can structural studies of M6_Spy0510 contribute to protein family classification?

Structural characterization of uncharacterized proteins like M6_Spy0510 can significantly advance protein classification and evolutionary understanding:

  • Novel fold identification: If M6_Spy0510 structure reveals a previously uncharacterized fold, researchers should:

    • Define the core structural elements

    • Identify minimal sequence requirements for fold maintenance

    • Search for remote homologs using structure-based algorithms

    • Propose new fold classification in structural databases

  • Hidden homology detection: Even with low sequence identity, structural studies may reveal unexpected evolutionary relationships:

    • Use DALI, FATCAT, or similar tools to identify structural similarity despite sequence divergence

    • Identify conserved structural motifs that may be obscured in sequence comparisons

    • Map sequence conservation patterns onto structural elements

  • Domain architecture analysis: Characterization of modular organization can place M6_Spy0510 in context:

Potential Domain TypeStructural IndicatorsFunctional Implications
Signal/targeting sequenceN-terminal hydrophobic region Secretion or membrane localization
Protein-protein interaction domainCentral alpha-helical regionComplex formation with host or bacterial factors
Functional domainC-terminal region with conserved residuesEnzymatic or binding activity
  • Evolutionary trajectory mapping: Structural information enables reconstruction of evolutionary history:

    • Map structural conservation across bacterial phyla

    • Identify structurally conserved but sequence-variable regions

    • Trace structural adaptations to different ecological niches

  • Integrative classification: Combine structural data with genomic context, expression patterns, and interaction networks to propose functional classification beyond traditional sequence-based approaches.

These structural studies may ultimately lead to establishing a new protein family or subfamily, advancing our understanding of bacterial protein evolution.

What considerations are important when using M6_Spy0510 in systems biology studies?

When incorporating M6_Spy0510 into systems biology research, several methodological considerations ensure meaningful integration:

  • Network integration approaches:

    • Implement guilt-by-association methods connecting M6_Spy0510 to proteins of known function

    • Use weighted gene correlation network analysis (WGCNA) to identify co-regulated clusters

    • Apply Bayesian networks to predict causal relationships

    • Consider protein-protein interaction network topology to predict function

  • Multi-omics data integration:

Omics LayerExperimental ApproachIntegration Method
TranscriptomicsRNA-seq with M6_Spy0510 mutantsDifferential expression analysis with pathway enrichment
ProteomicsGlobal proteomics with quantificationProtein abundance correlation networks
MetabolomicsUntargeted profilingMetabolic pathway impact analysis
InteractomicsAP-MS or BioID using tagged M6_Spy0510 Direct physical interaction mapping
  • Contextual data collection: Generate systems-level data under multiple conditions:

    • Different growth phases

    • Stress conditions (antibiotic, oxidative, nutrient)

    • Host-relevant environments

    • Different S. pyogenes strain backgrounds

  • Model building considerations:

    • Start with constraint-based modeling (e.g., COBRA techniques)

    • Progress to dynamic models if time-course data is available

    • Incorporate stochasticity for processes with high variability

    • Validate models with independent experimental approaches

  • Functional prediction validation:

    • Design targeted experiments to test predictions from systems models

    • Implement Bayesian experimental design to maximize information gain

    • Use CRISPR interference for transient perturbation to validate network connections

For uncharacterized proteins like M6_Spy0510, systems approaches are particularly valuable as they can provide functional context even before detailed biochemical characterization is complete.

What are the future research directions for M6_Spy0510?

Based on current knowledge and the gap analysis of M6_Spy0510 research, several promising future directions emerge:

  • Structural biology expansion: Determine the high-resolution structure of M6_Spy0510 using X-ray crystallography or cryo-EM to provide fundamental insights about potential function. The relatively small size (149 amino acids) makes it amenable to NMR studies as well, potentially revealing dynamic properties.

  • Functional genomics approaches: Apply genome-wide screening methods like Tn-seq or CRISPRi in S. pyogenes to identify genetic interactions with M6_Spy0510, revealing functional pathways and processes.

  • Host-pathogen interaction focus: Systematically investigate M6_Spy0510 interactions with human cellular components, particularly given the potential membrane-association indicated by its sequence features .

  • Post-translational modification characterization: Comprehensive analysis of potential modifications and their regulatory roles, especially focusing on the lysine-rich regions in the protein sequence .

  • Strain variation studies: Comparative analysis across different S. pyogenes strains to understand selective pressures and evolutionary constraints on M6_Spy0510.

  • Therapeutic targeting potential: Evaluation of M6_Spy0510 as a potential drug target or vaccine component through immunogenicity and essentiality studies.

  • Structural biology and drug discovery integration: If functionally important, structure-based drug design approaches targeting identified active sites or interaction interfaces.

The convergence of structural biology, systems approaches, and focused biochemical studies represents the most promising path forward for fully characterizing this uncharacterized protein and potentially revealing new aspects of streptococcal biology.

How can researchers effectively collaborate on M6_Spy0510 characterization projects?

Building effective collaborations for characterizing uncharacterized proteins like M6_Spy0510 requires structured approaches to maximize complementary expertise:

  • Collaborative framework organization:

    • Establish clear research questions and specific aims

    • Define distinct but complementary workpackages for each research group

    • Implement regular virtual meetings (biweekly recommended) for progress updates

    • Use shared electronic laboratory notebooks for real-time data sharing

    • Create standardized protocols for cross-laboratory validation

  • Material and method standardization:

    • Centralize production of key reagents (e.g., recombinant proteins, antibodies)

    • Establish common purification protocols and quality control metrics

    • Implement round-robin testing for critical assays

    • Create reference datasets for comparative analysis

  • Data integration strategies:

    • Utilize shared repositories with standardized metadata

    • Implement computational workflows that maintain data provenance

    • Develop visualization tools for integrating diverse experimental results

    • Create collaborative documents for real-time manuscript development

  • Expertise distribution model:

Research AspectRecommended ExpertiseCollaborative Contribution
Structural biologyX-ray crystallography/NMR3D structure determination
Molecular biologyMicrobial geneticsGene knockout and complementation
BiochemistryProtein-protein interactionsBinding partner identification
Cell biologyHost-pathogen interactionCellular effect characterization
BioinformaticsComputational biologyIntegrative data analysis
  • Resource sharing considerations:

    • Implement material transfer agreements early

    • Establish authorship guidelines and project governance

    • Create plans for data/reagent sharing post-publication

    • Consider pre-registration of study protocols

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.