Recombinant Uncharacterized protein Mb0008c (Mb0008c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cwsA; BQ2027_MB0008C; Cell wall synthesis protein CwsA; Cell wall synthesis and cell shape protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
cwsA
Target Protein Sequence
MSEQVETRLTPRERLTRGLAYSAVGPVDVTRGLLELGVGLGLQSARSTAAGLRRRYREGR LAREVAAAQETLAQELTAAQDVVANLPQALQDARTQRRSKHHLWIFAGIAAAILAGGAVA FSIVRRSSRPEPSPRPPSVEVQPRP
Uniprot No.

Target Background

Function

Recombinant Uncharacterized protein Mb0008c (Mb0008c) is required for regulated cell division, cell wall synthesis, and the maintenance of cell shape.

Protein Families
CwsA family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

Q: What expression systems are most suitable for recombinant Mb0008c production?

A: Recombinant Uncharacterized protein Mb0008c can be expressed and purified from several host systems, with E. coli and yeast offering the best yields and shorter turnaround times for initial characterization studies . For applications requiring post-translational modifications that may be essential for proper folding or activity, insect cells with baculovirus or mammalian expression systems are recommended alternatives, as these systems can provide many of the post-translational modifications necessary for correct protein folding or retention of protein activity . When selecting an expression system, researchers should consider the protein's origin (Mycobacterium bovis), its relatively small size (145 amino acids) , and the specific experimental requirements for downstream applications.

Q: How should I approach optimizing expression conditions for an uncharacterized protein like Mb0008c?

A: For uncharacterized proteins like Mb0008c, a systematic Design of Experiments (DoE) approach is strongly recommended rather than the inefficient one-factor-at-a-time method. Begin by identifying key variables affecting expression, such as induction temperature, inducer concentration, growth media composition, and induction timing . For example, in similar recombinant protein expression studies, researchers have optimized conditions by testing variables including absorbance at induction (e.g., 0.8 at 600 nm), inducer concentration (e.g., 0.1 mM IPTG), induction time (e.g., 4 hours), and temperature (e.g., 25°C) . The media composition should also be systematically tested, with variables like yeast extract concentration, tryptone levels, salt concentration, and carbon source (glucose) concentration being critical factors to optimize . Using statistical design methods such as factorial designs allows for simultaneous evaluation of multiple factors with fewer experiments while accounting for interaction effects between variables .

Q: What are the known structural and functional characteristics of Mb0008c?

A: As an uncharacterized protein, definitive structural and functional information about Mb0008c is limited. The protein is 145 amino acids in length and originates from Mycobacterium bovis. While specific functional domains have not been conclusively identified in the available literature, researchers should approach Mb0008c as they would other mycobacterial proteins of similar size. Comparative analysis with other mycobacterial proteins might reveal potential structural or functional homologs. For storage and handling, general guidelines for recombinant proteins should be followed, including avoiding repeated freeze-thaw cycles and storing working aliquots at 4°C for no more than one week (as recommended for similar mycobacterial proteins) . For long-term storage, maintaining the protein at -20°C/-80°C in appropriate buffer systems with stabilizing agents like glycerol is advisable .

Q: How can I assess the purity and integrity of recombinant Mb0008c?

A: Standard protein analytical techniques are recommended for assessing Mb0008c purity and integrity. SDS-PAGE should be used to verify protein size (expected to be approximately 145 amino acids plus any fusion tags) and to estimate purity (aim for >90% purity as a standard benchmark) . Western blotting using antibodies against any fusion tags (e.g., His-tag) can confirm protein identity. Mass spectrometry is essential for accurate molecular weight determination and verification of the complete amino acid sequence. Circular dichroism spectroscopy can provide insights into secondary structure elements. For assessment of proper folding, in the absence of known functional assays for this uncharacterized protein, intrinsic fluorescence spectroscopy and thermal shift assays might indicate whether the protein has adopted a stable tertiary structure. These analytical approaches should be systematically applied throughout the purification process to ensure the isolated protein maintains its integrity.

Q: How can I design a factorial experiment to optimize multiple variables for Mb0008c expression?

A: For Mb0008c expression optimization, implement a factorial design approach to efficiently analyze multiple variables simultaneously. Based on successful recombinant protein expression studies, consider a design examining 8 key variables :

FactorLow LevelHigh Level
Induction OD6000.61.0
IPTG concentration0.05 mM0.5 mM
Temperature25°C37°C
Induction time4 h16 h
Yeast extract2 g/L10 g/L
Tryptone2 g/L10 g/L
NaCl5 g/L15 g/L
Glucose0 g/L2 g/L
A fractional factorial design (e.g., 2^(8-4)) would reduce the experimental runs while still capturing main effects and some interactions . Use statistical software to generate the design matrix and analyze results, with soluble protein yield as your primary response variable. If solubility is an issue, include additional response variables such as total protein expression and soluble fraction percentage. This approach has proven effective in similar studies, where optimal conditions increased soluble protein yield to 250 mg/L compared to standard conditions . Once significant factors are identified, a response surface methodology can be applied to fine-tune the optimum conditions within narrower ranges of the significant variables.

Q: What statistical approaches are most appropriate for analyzing complex optimization data for Mb0008c expression?

A: For analyzing Mb0008c expression optimization data, appropriate statistical methods are essential for accurate interpretation. Analysis of variance (ANOVA) should be applied to factorial design data to identify statistically significant factors and interactions affecting protein expression . Main effects plots and interaction plots will visualize how individual factors and their combinations influence protein yield. For response surface methodology (RSM) experiments, regression analysis helps develop predictive models that can estimate optimal conditions. Statistical software packages like Design-Expert, JMP, or R with specialized packages are valuable for these analyses . When validating optimized conditions, use biological replicates (minimum triplicate experiments) to ensure reproducibility, as demonstrated in studies with pneumolysin expression . Calculate confidence intervals for protein yield predictions to understand the reliability of your optimized protocol. For complex datasets with multiple response variables (e.g., protein yield, purity, and biological activity), multivariate statistical approaches like principal component analysis can help identify patterns and relationships between different experimental outcomes and conditions.

Q: What are the recommended strategies for purifying Mb0008c for structural studies?

A: For structural studies of Mb0008c, a multi-step purification strategy is recommended to achieve the highest possible purity (>95%). Begin with affinity chromatography using an appropriate tag system - if expressing with an N-terminal His-tag as described for similar mycobacterial proteins , immobilized metal affinity chromatography (IMAC) should be your first step. Following initial capture, implement at least two orthogonal purification techniques: ion exchange chromatography based on the protein's theoretical isoelectric point, and size exclusion chromatography to eliminate aggregates and ensure monodispersity, which is critical for crystallization attempts. Buffer optimization is crucial - screen multiple buffer systems (e.g., Tris, HEPES, phosphate) at various pH values and salt concentrations to identify conditions that maximize stability. Consider incorporating thermal shift assays to evaluate buffer conditions systematically. For crystallization purposes, assess protein homogeneity by dynamic light scattering before attempting crystallization trials. If the protein exhibits conformational heterogeneity, limited proteolysis combined with mass spectrometry can identify stable domains that might be more amenable to crystallization. Throughout purification, monitor protein integrity using SDS-PAGE and activity assays if available.

Q: How can I approach functional characterization of an uncharacterized protein like Mb0008c?

A: Functional characterization of uncharacterized proteins like Mb0008c requires a systematic, multi-faceted approach. Begin with bioinformatic analysis using tools like BLAST, InterPro, and AlphaFold to predict potential functions based on sequence similarity, conserved domains, and structural modeling. Examine the genomic context of Mb0008c within Mycobacterium bovis to identify potential functional relationships with neighboring genes. For experimental characterization, implement a combination of techniques: differential scanning fluorimetry to identify potential ligand interactions; isothermal titration calorimetry to quantify binding affinities for predicted ligands; and activity assays based on predicted functions (e.g., enzymatic, DNA/RNA binding, or protein-protein interactions). Consider using transcriptomic and proteomic approaches to identify conditions that regulate Mb0008c expression in its native host. Pull-down assays using tagged Mb0008c can identify interaction partners that might provide functional insights. Additionally, gene knockout or knockdown studies in Mycobacterium bovis, if feasible, can reveal phenotypic effects that suggest function. A complementary approach is heterologous expression in a model organism to observe gain-of-function phenotypes. Document all negative results alongside positive findings, as these provide valuable constraints on potential functions.

Q: What are the comparative advantages of different expression systems for Mb0008c?

A: Different expression systems offer distinct advantages for Mb0008c production, and selection should be based on research objectives:

Expression SystemAdvantagesDisadvantagesRecommended Use Case
E. coliHigh yields, rapid growth, cost-effective, well-established protocols, simple media requirements Limited post-translational modifications, potential inclusion body formationInitial characterization, structural studies requiring high protein quantities
YeastModerate to high yields, eukaryotic post-translational modifications, secretion capability, shorter turnaround times More complex media, longer optimization time than E. coliStudies requiring simple glycosylation, disulfide bonds
Insect cells (Baculovirus)Complex post-translational modifications, proper protein folding for complex proteins Lower yields, longer production time, higher costFunctional studies where activity depends on proper folding or modifications
Mammalian cellsMost comprehensive post-translational modifications, native-like protein structure Lowest yields, highest cost, longest production timeStudies requiring authentic mammalian modifications or when other systems fail
For Mb0008c, a sequential approach is recommended: begin with E. coli for initial characterization and structural studies, then advance to higher organisms if functional activity is not achieved or if specific modifications are required. When using E. coli, consider specialized strains designed for mycobacterial proteins that may optimize codon usage or provide additional folding assistance through chaperones.

Q: What strategies should I employ when Mb0008c shows poor solubility in E. coli expression systems?

A: When encountering poor solubility with Mb0008c in E. coli, implement the following systematic troubleshooting strategy:

  • Modify expression conditions through DoE approach: Lower induction temperature to 15-25°C, reduce inducer concentration to 0.05-0.1 mM IPTG, and extend expression time to 16-24 hours . These adjustments slow protein synthesis, potentially improving folding.

  • Implement fusion tag strategies: Test multiple solubility-enhancing tags such as SUMO, MBP, TrxA, or GST in parallel expressions to identify optimal construct design.

  • Optimize media composition: Supplement with additives known to enhance protein solubility:

    • 0.5-2% glucose to reduce basal expression in T7-based systems

    • 1-10 mM betaine as a chemical chaperone

    • 100-500 mM NaCl to increase ionic strength

    • 5-10% glycerol to stabilize folding intermediates

  • Employ co-expression strategies: Co-express with molecular chaperones (GroEL/ES, DnaK/J, trigger factor) to assist proper folding, particularly important for heterologous proteins like those from Mycobacterium.

  • Consider cell-free expression systems: These eliminate cellular toxicity concerns and allow direct manipulation of the folding environment.
    If all soluble expression attempts fail, develop a refolding protocol from inclusion bodies using techniques like rapid dilution, dialysis, or on-column refolding. Document each approach systematically to build a comprehensive understanding of Mb0008c's expression behavior.

Q: How can I determine if my purified Mb0008c is correctly folded without known activity assays?

A: Determining correct folding of purified Mb0008c without established activity assays requires a multi-pronged biophysical characterization approach:

  • Size exclusion chromatography profile analysis: A symmetrical, monodisperse peak suggests a homogeneous, well-folded protein, while asymmetrical profiles or void volume elution indicates aggregation or misfolding.

  • Circular dichroism (CD) spectroscopy: Analyze secondary structure content and compare with bioinformatic predictions based on the Mb0008c sequence. Well-defined spectra with characteristic signatures of secondary structure elements (α-helices, β-sheets) suggest proper folding.

  • Intrinsic fluorescence spectroscopy: Tryptophan and tyrosine residues in properly folded proteins exhibit characteristic emission spectra. Buried residues in the hydrophobic core typically display blue-shifted emission maxima compared to exposed residues.

  • Thermal shift assays: Well-folded proteins show cooperative unfolding transitions with sigmoidal melting curves when heated gradually. Sharp transitions with high melting temperatures generally indicate stable, well-folded structures.

  • Limited proteolysis: Properly folded proteins typically show resistance to proteolysis except at exposed flexible regions. Analyze digestion patterns using SDS-PAGE and mass spectrometry to identify stable domains.

  • Nuclear magnetic resonance (NMR) 1D proton spectra: Well-dispersed peaks in the amide and methyl regions indicate a folded protein with a defined tertiary structure.

  • Comparative analysis: Compare biophysical characteristics with other characterized proteins from Mycobacterium bovis of similar size to establish benchmarks for proper folding.
    Combining these approaches provides a comprehensive assessment of Mb0008c folding status even without functional assays.

Q: What approaches can help identify the physiological role of uncharacterized protein Mb0008c?

A: To elucidate the physiological role of Mb0008c, implement a comprehensive multi-omics strategy. Begin with comparative genomics analysis of Mb0008c across mycobacterial species, examining gene neighborhood conservation and co-evolution patterns that may suggest functional relationships. Perform protein-protein interaction studies using pull-down assays with tagged Mb0008c followed by mass spectrometry to identify binding partners. Implement CRISPR interference or gene knockout in Mycobacterium bovis if feasible, and analyze resulting phenotypes under various growth conditions to observe physiological effects. Complement in vivo studies with in vitro biochemical assays testing potential enzymatic activities based on sequence or structural similarities to characterized proteins. Metabolomic profiling comparing wild-type and Mb0008c mutant strains can identify metabolic pathways affected by the protein. Additionally, examine Mb0008c expression patterns under different stress conditions (oxidative stress, nutrient limitation, host-like environments) using RNA-seq and proteomics to identify conditions that regulate its expression, providing clues to its function. Structural determination through X-ray crystallography or cryo-EM can reveal potential active sites or binding pockets that suggest function. This multi-faceted approach increases the probability of uncovering the physiological role of this uncharacterized protein.

Q: How can crystallization trials be optimized for an uncharacterized protein like Mb0008c?

A: Optimizing crystallization trials for Mb0008c requires a systematic approach tailored to uncharacterized proteins. First, ensure protein purity exceeds 95% as assessed by SDS-PAGE and size exclusion chromatography, as contaminants often inhibit crystal formation. Verify protein homogeneity through dynamic light scattering, aiming for polydispersity index values below 20%. Prepare multiple protein constructs with varying N- and C-terminal boundaries to increase crystallization chances, as flexible termini can hinder lattice formation. Consider surface entropy reduction by mutating clusters of high-entropy residues (Lys, Glu) to alanine based on bioinformatic predictions. Implement a comprehensive initial screening approach using commercial sparse matrix screens at multiple protein concentrations (5-15 mg/ml) and temperatures (4°C and 20°C). For proteins resistant to crystallization, explore alternative approaches including in situ proteolysis during crystallization setups, co-crystallization with potential ligands identified through thermal shift assays, and formation of antibody complexes to provide crystal contacts. Apply microseeding techniques to promising conditions showing even minor crystalline material. Document all conditions systematically, as even unsuccessful trials provide valuable information about the protein's behavior. This methodical approach maximizes the chances of obtaining diffraction-quality crystals of Mb0008c for structural studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.