Recombinant Uncharacterized protein Mb0093 (Mb0093)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
BQ2027_MB0093; Uncharacterized protein Mb0093
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB0093
Target Protein Sequence
MAKNQNRIRNRWELITCGLGGHVTYAPDDAALAARLRASTGLGEVWRCLRCGDFALGGPQ GRGAPEDAPLIMRGKALRQAIIIRALGVERLVRALVLALAAWAVWEFRGARGAIQATLDR DLPVLRAAGFKVDQMTVIHALEKALAAKPSTLALITGMLAAYAVLQAVEGVGLWLLKRWG EYFAVVATSIFLPLEVHDLAKGITTTRVVTFSINVAAVVYLLISKRLFGVRGGRKAYDVE RRGEQLLDLERAAMLT
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant Mb0093?

E. coli-based expression systems are predominantly used for recombinant Mb0093 production, with BL21(DE3) being the most commonly employed strain for heterologous protein expression. This preference aligns with broader trends in industrial enzyme expression, where B strains like BL21(DE3) are used in 65% of cases compared to K12 derivatives . The advantages of BL21(DE3) for Mb0093 expression include:

  • Deficiency in Lon and OmpT proteases, providing protection to the recombinant protein from degradation

  • Shorter doubling time (approximately 20 minutes)

  • Rapid protein synthesis via the T7 expression system

  • Capacity to generate higher biomass compared to K12 strains

For Mb0093 specifically, expression systems utilizing N-terminal His-tagging have been successfully implemented . This approach facilitates downstream purification while minimizing potential interference with protein folding. For difficult-to-express proteins with solubility issues, specialized strains like ArcticExpress(DE3) or Rosetta(DE3) may offer advantages through enhanced chaperone activity or optimization of rare codon usage.

What are the optimal storage and handling conditions for recombinant Mb0093?

Proper storage and handling of recombinant Mb0093 are critical for maintaining protein integrity and activity. Based on established protocols, the following conditions are recommended:

  • Long-term storage: Store the lyophilized powder at -20°C or -80°C upon receipt .

  • Working solution preparation: Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Aliquoting: Add glycerol to a final concentration of 5-50% (preferably 50%) and prepare small aliquots to avoid repeated freeze-thaw cycles .

  • Working aliquots: Store at 4°C for up to one week to minimize degradation .

  • Buffer conditions: Tris/PBS-based buffer with 6% Trehalose, pH 8.0 has been shown to maintain stability .

Repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein stability and activity. Prior to reconstitution, it is advisable to briefly centrifuge the vial to ensure all material is at the bottom. These handling protocols are essential for experimental reproducibility and obtaining reliable results in downstream applications.

How should experimental designs be structured when investigating an uncharacterized protein like Mb0093?

When designing experiments for Mb0093 characterization, applying systematic design of experiments (DOE) principles is crucial. The experimental design should aim to predict outcomes by introducing controlled variations in conditions that might affect protein behavior . Key considerations include:

  • Independent variables selection: Identify factors likely to influence Mb0093 behavior (e.g., temperature, pH, buffer composition, interaction partners).

  • Dependent variable measurement: Define clear, measurable outputs (e.g., solubility, activity, binding affinity).

  • Control variable management: Maintain consistency in factors not being tested to prevent external influences .

  • Statistical optimization: Implement factorial or response surface designs to efficiently explore the experimental space with limited resources.

  • Validation strategy: Include appropriate positive and negative controls, particularly challenging with uncharacterized proteins.

The experimental approach should establish validity, reliability, and replicability by carefully selecting variables, reducing measurement error, and providing detailed methodological documentation . For proteins like Mb0093 where function is unknown, parallel experimental paths examining structure, interacting partners, and expression patterns can provide convergent evidence toward functional characterization.

What are the basic protocols for solubility assessment of recombinant Mb0093?

Assessing the solubility of recombinant Mb0093 is a critical initial step before proceeding with purification and functional studies. A systematic solubility assessment protocol should include:

  • Small-scale expression testing:

    • Express protein in 5-10 ml cultures under varying conditions

    • Test multiple temperatures (37°C, 30°C, 25°C, 18°C)

    • Evaluate different induction parameters (IPTG concentration: 0.1-1.0 mM)

    • Compare expression durations (3h, 6h, overnight)

  • Cellular fractionation:

    • Harvest cells and resuspend in lysis buffer

    • Sonicate or use alternative lysis methods

    • Centrifuge to separate soluble (supernatant) and insoluble (pellet) fractions

    • Analyze both fractions by SDS-PAGE

  • Quantitative solubility determination:

    • Measure protein concentration in soluble fraction

    • Calculate solubility percentage (soluble protein/total protein × 100%)

    • Document conditions yielding highest solubility

The formation of inclusion bodies is a common challenge with recombinant proteins in E. coli, especially with proteins of non-E. coli origin . If Mb0093 shows limited solubility, more advanced strategies may be required, including co-expression with chaperones or fusion to solubility-enhancing tags. These systematic approaches provide a foundation for optimizing expression conditions before scaling up production.

What strategies can improve solubility of Mb0093 during recombinant expression?

When Mb0093 presents solubility challenges, multiple advanced strategies can be implemented to enhance soluble expression. The selection should be based on a systematic approach rather than trial-and-error:

For Mb0093 specifically, a multi-parametric approach combining lower temperature expression (18°C) with BL21(DE3) or specialized strains like ArcticExpress has shown promise for difficult-to-express mycobacterial proteins . The hydrophobic regions in Mb0093's sequence suggest it may benefit from membrane protein expression strategies or fusion to highly soluble partners. Additionally, systematic testing of induction conditions (IPTG concentration, induction time, cell density at induction) can significantly impact solubility outcomes.

How can functional characterization of uncharacterized protein Mb0093 be approached methodologically?

Functional characterization of Mb0093 requires a multi-dimensional strategy that integrates computational predictions with experimental validation:

  • Computational approaches:

    • Sequence homology analysis against characterized proteins

    • Structural prediction using AlphaFold2 or similar tools

    • Identification of conserved domains and motifs

    • Genomic context analysis (neighboring genes often have related functions)

    • Protein-protein interaction network prediction

  • Experimental validation:

    • Phenotypic analysis of knockout/overexpression mutants

    • Protein-protein interaction studies (pull-downs, yeast two-hybrid)

    • Subcellular localization determination using fluorescent tagging

    • Activity assays based on predictive computational analyses

    • Structural studies (X-ray crystallography, cryo-EM)

The experimental design should follow DOE principles with careful selection of independent variables and appropriate controls . For Mb0093, the presence of potential membrane-associated domains suggests investigating membrane-related functions. Integration of multiple lines of evidence is crucial, as single approaches rarely provide conclusive functional assignments for uncharacterized proteins.

What advanced purification techniques are recommended for obtaining high-purity Mb0093 for structural studies?

Obtaining highly pure Mb0093 for structural studies requires sophisticated purification strategies beyond basic affinity chromatography:

  • Multi-step purification protocol:

    • Initial IMAC (Immobilized Metal Affinity Chromatography) utilizing the His-tag

    • Secondary purification through ion exchange chromatography

    • Size exclusion chromatography as a polishing step

    • Validation of >95% purity through SDS-PAGE and mass spectrometry

  • Optimized buffer conditions:

    • Screen multiple buffer systems (Tris, HEPES, phosphate)

    • Optimize pH range (typically 7.0-8.5)

    • Test stabilizing additives (glycerol, trehalose, specific ions)

    • Consider detergents if membrane association is suspected

  • Tag removal considerations:

    • Precise protease cleavage of His-tag if required for structural studies

    • Secondary IMAC to remove cleaved tag and protease

    • Buffer exchange to remove imidazole

  • Quality control metrics:

    • Dynamic light scattering to assess monodispersity

    • Thermal shift assays to evaluate stability

    • Activity assays (if available) to confirm functional integrity

For crystallography specifically, protein engineering approaches like surface entropy reduction or targeted mutations of cysteine residues might enhance crystallization propensity. These advanced purification strategies significantly increase the likelihood of successful structural determination of Mb0093.

How can systems biology approaches enhance understanding of Mb0093's role in Mycobacterium bovis?

Systems biology offers powerful frameworks for contextualizing Mb0093 within broader biological networks in Mycobacterium bovis:

  • Transcriptomic analysis:

    • RNA-seq under various conditions to identify co-regulated genes

    • Differential expression analysis during infection or stress conditions

    • Correlation of Mb0093 expression with known virulence factors

  • Proteomic approaches:

    • Identification of protein-protein interaction partners through IP-MS

    • Phosphoproteomics to identify potential regulatory mechanisms

    • Comparative proteomics between wild-type and Mb0093 mutant strains

  • Metabolomic integration:

    • Metabolic profiling of Mb0093 knockout/overexpression strains

    • Flux analysis to identify affected metabolic pathways

    • Correlation of metabolic changes with phenotypic alterations

  • Network analysis:

    • Construction of integrated networks incorporating multiple omics datasets

    • Identification of functional modules containing Mb0093

    • Network perturbation analysis to predict system-wide effects

This holistic approach aligns with modern trends in protein characterization, moving beyond isolated functional studies to understand proteins within their biological context . For Mb0093, systems-level analysis could reveal connections to known virulence mechanisms or metabolic pathways in Mycobacterium bovis, providing insights not accessible through traditional reductionist approaches.

What specialized analytical techniques can resolve contradictory data when studying Mb0093?

When facing contradictory experimental results with Mb0093, specialized analytical approaches can help resolve discrepancies:

  • Protein heterogeneity assessment:

    • Native mass spectrometry to identify protein states

    • Analytical ultracentrifugation to characterize oligomeric states

    • Hydrogen-deuterium exchange mass spectrometry to detect conformational differences

  • Advanced biophysical characterization:

    • Surface plasmon resonance for quantitative binding studies

    • Isothermal titration calorimetry for thermodynamic profiling

    • Microscale thermophoresis for detecting weak interactions

  • Statistical and computational resolution:

    • Bayesian statistical approaches to integrate contradictory datasets

    • Machine learning classification of experimental conditions leading to different outcomes

    • Molecular dynamics simulations to investigate conformational variability

  • Orthogonal validation:

    • In vivo confirmation of in vitro findings

    • Cross-validation using multiple detection methods

    • Independent replication in different laboratories

A systematic experimental design approach is particularly valuable when resolving contradictions, as it can identify interaction effects between variables that might explain divergent results . For Mb0093, careful documentation of all experimental conditions and implementation of DOE principles can significantly reduce the occurrence of contradictory data and facilitate resolution when contradictions arise.

What steps should be taken when recombinant Mb0093 forms inclusion bodies?

Inclusion body formation is a common challenge with heterologous expression of proteins like Mb0093 in E. coli. When inclusion bodies form, the following structured approach can be implemented:

  • Prevention strategies (primary approach):

    • Reduce expression temperature to 15-18°C

    • Decrease inducer concentration (0.01-0.1 mM IPTG)

    • Co-express with molecular chaperones (GroEL/ES, DnaK/DnaJ/GrpE)

    • Use strains like ArcticExpress with cold-adapted chaperones

    • Consider switching to specialized expression hosts

  • Refolding from inclusion bodies (if prevention fails):

    • Isolate inclusion bodies using differential centrifugation

    • Solubilize using chaotropic agents (8M urea or 6M guanidine hydrochloride)

    • Remove denaturant through dialysis or dilution

    • Add adjuvants (L-arginine, glycerol, low concentrations of detergents)

    • Implement step-wise reduction of denaturant concentration

  • Protein engineering approaches:

    • Create fusion constructs with solubility enhancers (MBP, SUMO, Thioredoxin)

    • Perform truncation analysis to identify soluble domains

    • Introduce targeted mutations in aggregation-prone regions

The research field currently lacks a standardized approach for promoting solubility of recombinant proteins, with disparate practices being employed . For Mb0093 specifically, the systematic testing of expression conditions should be prioritized before attempting refolding, as native folding typically yields higher-quality protein for downstream analyses.

How can low expression yields of Mb0093 in E. coli be addressed?

Low expression yields of Mb0093 can significantly hinder research progress. A methodical approach to improving yields includes:

  • Optimizing gene and vector design:

    • Codon optimization for E. coli preferences

    • Evaluation of alternative promoter systems (T7, tac, ara)

    • Optimization of ribosome binding site strength

    • Screening multiple vector backbones for compatibility

  • Host strain selection:

    • Compare expression levels in different E. coli strains

    • Consider strains with extra copies of rare tRNAs (like Rosetta)

    • Evaluate strains with modified metabolic capabilities

  • Growth and induction optimization:

    • Systematic testing of media compositions (LB, TB, autoinduction)

    • Optimization of cell density at induction (OD600 0.4-1.0)

    • Implementation of fed-batch cultivation strategies

    • Evaluation of induction duration (3h to overnight)

  • Scale-up considerations:

    • Analysis of oxygen transfer limitations

    • Monitoring of acetate production and pH shifts

    • Implementation of controlled feeding strategies

The experimental design should follow DOE principles to efficiently identify optimal conditions . For Mb0093, if the protein function is suspected to be toxic to E. coli, using tightly controlled expression systems or strains containing pLysS plasmid might be beneficial. Additionally, monitoring expression kinetics through time-course sampling can identify optimal harvest times to balance yield and solubility.

What quality control metrics should be implemented for Mb0093 research reproducibility?

Ensuring reproducibility in Mb0093 research requires rigorous quality control metrics throughout the experimental workflow:

  • Protein identity and integrity verification:

    • Mass spectrometry confirmation of intact protein mass

    • N-terminal sequencing to verify correct processing

    • Western blotting with tag-specific and protein-specific antibodies

    • Peptide mass fingerprinting following protease digestion

  • Purity assessment:

    • Densitometric analysis of SDS-PAGE (>90% purity standard)

    • Size exclusion chromatography profiles

    • Capillary electrophoresis

    • Evaluation of endotoxin levels for in vivo applications

  • Stability monitoring:

    • Thermal shift assays to assess folding stability

    • Time-course analysis of activity retention

    • Monitoring of aggregation by dynamic light scattering

    • Freeze-thaw stability assessments

  • Batch consistency measures:

    • Standard operating procedures for expression and purification

    • Comparison of batch-to-batch variation in critical parameters

    • Implementation of reference standards

    • Detailed documentation of all experimental conditions

The field currently shows gaps in reporting consistent metadata in publications, impacting reproducibility . For Mb0093 research, maintaining comprehensive records of expression conditions, purification protocols, and quality control results is essential for interpreting results across different studies and experimental approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.