Recombinant Uncharacterized protein Mb0508 (Mb0508)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customer use.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
BQ2027_MB0508; Uncharacterized protein Mb0508
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB0508
Target Protein Sequence
MTGPHPETESSGNRQISVAELLARQGVTGAPARRRRRRRGDSDAITVAELTGEIPIIRDD HHHAGPDAHASQSPAANGRVQVGEAAPQSPAEPVAEQVAEEPTRTVYWSQPEPRWPKSPP QDRRESGPELSEYPRPLRHTHSDRAPAGPPSGAEHMSPDPVEHYPDLWVDVLDTEVGEAE AETEVREAQPGRGERHAAAAAAGTDVEGDGAAEARVARRALDVVPTLWRGALVVLQSILA VAFGAGLFIAFDQLWRWNSIVALVLSVMVILGLVVSVRAVRKTEDIASTLIAVAVGALIT LGPLALLQSG
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mb0508 and what are its basic characteristics?

Mb0508 is an uncharacterized protein from Mycobacterium bovis with 310 amino acids in length. According to available data, it corresponds to UniProt accession number P64716 . The protein is equivalent to Rv0497 in Mycobacterium tuberculosis strain H37Rv . The complete amino acid sequence starts with MTGPHPETESSGNRQISVAELLARQGVTGAPA and continues as documented in product information .

For basic characterization, researchers should:

  • Calculate theoretical molecular weight (~33.5 kDa without tags) and isoelectric point using ExPASy ProtParam

  • Analyze hydrophobicity profile to predict membrane association

  • Examine the sequence for conserved motifs using InterPro or SMART databases

  • Analyze potential post-translational modifications using NetPhos or other prediction tools

Note that recombinant versions with tags may have modified properties compared to the native protein.

How should I design experimental approaches to study an uncharacterized protein like Mb0508?

Studying uncharacterized proteins requires a multi-dimensional approach:

  • Bioinformatic analysis:

    • Sequence similarity searches using BLASTP

    • Domain prediction using PFAM, InterPro

    • Structural prediction using AlphaFold2

    • Genomic context analysis with neighboring genes

  • Expression and purification strategy:

    • Test multiple expression systems (bacterial, yeast, mammalian)

    • Optimize codons for expression host

    • Use solubility-enhancing tags (MBP, SUMO)

    • Employ multi-step purification for highest purity (>95%)

  • Functional characterization:

    • Subcellular localization studies

    • Knockout/knockdown phenotypic analysis

    • Protein-protein interaction studies

    • Comparative analysis with homologs in related species

This approach aligns with methodology used for other uncharacterized mycobacterial proteins, where researchers progressively built understanding through complementary techniques .

What expression systems are available for Mb0508 and their comparative advantages?

Multiple expression systems can be used for Mb0508, each with distinct advantages:

Expression SystemAdvantagesDisadvantagesRecommended Applications
E. coliHigh yield (0.5-1 mg) , cost-effective, simple setupMay lack PTMs, inclusion body formationStructural studies, antibody production
YeastEukaryotic PTMs, secretion possibleLower yield, complex mediaFunctional studies requiring glycosylation
BaculovirusComplex eukaryotic modificationsTechnical expertise requiredStructural biology of complex proteins
MammalianNative-like modificationsHighest cost, lowest yieldInteraction studies, functional assays

For Mb0508, starting with E. coli expression is recommended as mycobacterial proteins often express well in bacterial systems. If solubility issues arise, consider:

  • Using Tris-based buffer with 50% glycerol as demonstrated effective for stability

  • Adding solubility enhancers like arginine or low concentrations of detergents

  • Testing multiple fusion tags to identify optimal solubility

How can I predict the potential function of Mb0508?

Predicting the function of uncharacterized proteins like Mb0508 requires integrating multiple approaches:

  • Comparative genomics:

    • Examine orthologs in related species (Mb0508 is equivalent to Rv0497 in M. tuberculosis)

    • Analyze gene neighborhood conservation across mycobacteria

    • Identify any characterized homologs in other bacteria

  • Expression pattern analysis:

    • Analyze under what conditions the gene is expressed

    • Study if expression changes during infection stages

    • Compare expression in virulent vs. attenuated strains (like M. bovis Ravenel)

  • Structural prediction and analysis:

    • Use ModBase 3D structure mentioned in product information

    • Apply AlphaFold2 for enhanced structural prediction

    • Identify structural similarities to proteins of known function

  • Metabolic context:

    • Determine if the gene is part of a known metabolic pathway

    • Use flux balance analysis to predict importance in metabolism

    • Analyze co-expression with genes of known function

The combination of these approaches has successfully revealed functions of previously uncharacterized proteins, as demonstrated in the identification of SANBR protein as a negative regulator of CSR .

What techniques can I use to study Mb0508 localization in mycobacterial cells?

Understanding the cellular localization of Mb0508 is crucial for functional characterization:

  • Computational prediction:

    • Analyze for signal peptides using SignalP

    • Predict transmembrane domains using TMHMM

    • Search for sorting signals with PSORT

  • Experimental approaches:

    • Subcellular fractionation: Use differential centrifugation to separate cell wall, membrane, and cytosolic fractions

    • Triton X-114 phase separation: Particularly effective for mycobacterial membrane proteins as demonstrated in research

    • Fluorescent protein fusion: Create Mb0508-GFP fusion and visualize localization

    • Immunolocalization: Generate antibodies against Mb0508 for immunofluorescence or immunogold EM

  • Quantitative analysis:

    • Determine enrichment ratios between different fractions

    • Calculate relative abundance in each compartment

    • Compare localization under different growth conditions

For mycobacterial proteins, careful attention to cell wall disruption is essential due to their complex cell envelope. The Triton X-114 phase separation method has successfully identified over 100 membrane and membrane-associated proteins in mycobacteria, including approximately 50% of all predicted lipoproteins in the genome .

How can I identify potential interaction partners of Mb0508?

Identifying protein interaction partners is essential for understanding function:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged Mb0508 in mycobacteria

    • Perform pull-down experiments under physiological conditions

    • Identify co-purified proteins by LC-MS/MS

    • Use proper controls (tag-only, unrelated protein)

  • Bacterial two-hybrid system:

    • Create fusion constructs with split reporter domains

    • Screen against a library of mycobacterial proteins

    • Validate interactions with co-immunoprecipitation

  • Proximity-dependent labeling:

    • Fuse Mb0508 to BioID or APEX2

    • Express in mycobacteria to label proximal proteins

    • Identify biotinylated proteins by mass spectrometry

  • Computational predictions:

    • Use STRING database to predict functional associations

    • Analyze co-expression patterns across different conditions

    • Examine structural docking predictions

A combined approach of computational prediction followed by experimental validation has proven effective for mycobacterial proteins, as demonstrated in studies of M. tuberculosis secreted and membrane proteomes .

What structural analysis methods are appropriate for Mb0508?

Structural characterization of Mb0508 can employ multiple complementary techniques:

For initial assessment, experimental design modeling as described in research on proteomics experiments can help determine which methods are most likely to succeed with available resources.

How can I assess the quality and integrity of purified recombinant Mb0508?

Quality assessment of purified Mb0508 requires multiple analytical techniques:

  • Purity assessment:

    • SDS-PAGE with densitometric analysis

    • Size exclusion chromatography (SEC)

    • Mass spectrometry for accurate mass determination

    • Goal: achieve >95% purity as described in product specifications

  • Structural integrity:

    • Circular dichroism (CD) to assess secondary structure

    • Fluorescence spectroscopy to examine tertiary structure

    • Thermal shift assay to determine stability

    • Dynamic light scattering to detect aggregation

  • Functional validation:

    • Binding assays if ligands are known

    • Activity assays if function is predicted

    • Interaction studies with known partners

  • Storage stability:

    • Assess protein after storage at recommended conditions (-20°C for regular storage, -80°C for extended storage)

    • Monitor for degradation products

    • Test activity retention over time

    • Avoid repeated freeze-thaw cycles as recommended in product guidelines

The quality assessment strategy should be tailored to the downstream applications, with more stringent criteria for structural studies than for antibody production.

What computational methods can predict Mb0508 structure, and how reliable are they?

Computational structure prediction has advanced significantly and offers valuable insights for uncharacterized proteins:

  • State-of-the-art prediction methods:

    • AlphaFold2: Highest accuracy with typical backbone RMSD <2Å

    • RoseTTAFold: Alternative deep learning approach

    • I-TASSER: Iterative threading and refinement

    • ModBase: Contains existing model for P64716 (Mb0508)

  • Reliability assessment:

    MethodStrengthsLimitationsConfidence Metrics
    AlphaFold2Highest accuracyLess reliable for disordered regionspLDDT score (0-100)
    RoseTTAFoldFast, handles complexesSlightly lower accuracyConfidence score
    I-TASSERGood for unusual foldsComputationally intensiveC-score (-5 to 2)
    Homology modelingBased on experimental dataRequires suitable templateQMEAN score
  • Validation approaches:

    • Compare predictions from multiple methods

    • Evaluate stereochemical quality with MolProbity

    • Check for agreement with experimental data (if available)

    • Analyze conservation of predicted functional residues

  • Application to experimental design:

    • Guide construct design for expression

    • Identify domains for structural studies

    • Select residues for mutagenesis

    • Inform hypotheses about function

Computational predictions can significantly enhance experimental design efficiency, similar to the simulation-based optimization approach described for proteomics experiments .

How might Mb0508 contribute to M. bovis pathogenesis?

While specific evidence for Mb0508's role in pathogenesis is not directly provided in the search results, research approaches could include:

  • Comparative genomics:

    • Compare Mb0508 sequence across virulent and attenuated strains like M. bovis Ravenel

    • Analyze conservation in pathogenic vs. non-pathogenic mycobacteria

    • Examine single nucleotide polymorphisms in clinical isolates

  • Gene expression analysis:

    • Study Mb0508 expression during infection of bovine macrophages

    • Compare expression in different growth phases and stress conditions

    • Analyze regulation in response to host immune factors

  • Knockout studies:

    • Generate Mb0508 deletion mutant in M. bovis

    • Assess growth in standard media and under stress conditions

    • Evaluate survival in macrophages and animal models

    • Measure impact on immune response using methods for detecting M. bovis-specific T cells

  • Host interaction studies:

    • Test if Mb0508 interacts with host proteins

    • Assess immunogenicity similar to studies of M. tuberculosis antigens

    • Determine if Mb0508 modulates host immune responses

Understanding Mb0508's potential role in pathogenesis would contribute to the broader knowledge of M. bovis virulence mechanisms, complementing studies on strain-specific virulence factors .

How can I determine if Mb0508 is a potential drug target or diagnostic marker?

Evaluating Mb0508 as a drug target or diagnostic marker requires systematic assessment:

  • Drug target evaluation:

    • Essentiality: Determine if gene knockout is lethal

    • Conservation: Assess presence across mycobacterial species

    • Uniqueness: Compare to host proteins to minimize off-target effects

    • Druggability: Analyze structure for potential binding pockets

    • Validation: Confirm that inhibition affects bacterial viability

  • Diagnostic marker assessment:

    • Specificity: Confirm uniqueness to M. bovis/tuberculosis complex

    • Immunogenicity: Test antibody production in infected animals

    • Accessibility: Determine if protein is secreted or surface-exposed

    • Abundance: Measure expression levels during infection

    • Detection: Develop assays based on antibody recognition or nucleic acid detection

  • Experimental approaches:

    • Develop in vitro binding assays for compound screening

    • Test immunoreactivity with sera from infected animals

    • Evaluate sensitivity and specificity in diagnostic formats

    • Compare with established diagnostic markers like ESAT-6 and CFP-10

For diagnostic applications, the approach would be similar to the identification of novel antigens described in tuberculosis research, where 20 serological reactive proteins were identified including 4 novel antigens .

What methodologies can assess Mb0508 role in host-pathogen interactions?

Investigating Mb0508's role in host-pathogen interactions requires specialized techniques:

  • Infection models:

    • Macrophage infection with wild-type vs. Mb0508 mutant M. bovis

    • Ex vivo tissue models to mimic natural infection sites

    • Animal models (bovine) to assess full pathogenesis

    • Compare with established M. bovis strains like Ravenel

  • Immune response analysis:

    • Measure T cell responses to Mb0508 using methods described for detecting M. bovis-specific T cells

    • Assess cytokine production profiles (IFN-γ, IL-4, etc.)

    • Determine antibody responses in infected animals

    • Compare immune recognition with known immunodominant antigens

  • Host response characterization:

    • Transcriptomic analysis of infected cells

    • Proteomic changes in response to purified Mb0508

    • Signaling pathway activation studies

    • Cell death/survival assessment

  • Advanced imaging techniques:

    • Track Mb0508-GFP fusion during infection

    • Visualize host-pathogen interfaces

    • Monitor subcellular trafficking in real-time

    • Co-localize with host defense components

These methodologies would build on established techniques for studying mycobacterial infections, such as those used to characterize M. bovis strain Ravenel attenuation in cattle and enhanced detection of M. bovis-specific T cells .

How can I design site-directed mutagenesis experiments to probe Mb0508 function?

Site-directed mutagenesis offers powerful insights into protein function:

  • Target selection strategies:

    • Conserved residues identified through multiple sequence alignment

    • Predicted functional sites from structural models

    • Charged surface residues potentially involved in interactions

    • Potential post-translational modification sites

  • Systematic mutagenesis approach:

    • Alanine-scanning of conserved regions

    • Conservative vs. non-conservative substitutions

    • Creation of chimeric proteins with homologs

    • Domain swapping to test modular functions

  • Functional assessment:

    • Express and purify mutant proteins

    • Compare structural integrity with wild-type

    • Assess impact on predicted activities

    • Test cellular phenotypes in complementation studies

  • Data analysis framework:

    Mutation TypePurposeAnalysis MethodExpected Outcome
    Alanine substitutionRemove side chainActivity comparisonIdentify essential residues
    Conservative substitutionMaintain chemical propertiesRelative activityTest chemical requirements
    Cysteine substitutionEnable labelingAccessibility studiesMap structural features
    TruncationsTest domain functionDomain-specific assaysIdentify minimal functional unit

This approach aligns with research on other uncharacterized proteins, such as the SANBR protein, where domain-specific mutations (BTB domain) revealed functional dependencies .

What are the best approaches to study evolutionary conservation of Mb0508 across mycobacterial species?

Evolutionary analysis provides valuable functional insights:

  • Comprehensive sequence analysis:

    • Collect Mb0508 homologs across mycobacterial species

    • Perform multiple sequence alignment

    • Calculate conservation scores for each position

    • Identify absolutely conserved vs. variable regions

  • Phylogenetic analysis:

    • Construct phylogenetic trees using maximum likelihood methods

    • Compare with species phylogeny to detect horizontal gene transfer

    • Map key mutations to evolutionary branches

    • Correlate with host range or pathogenicity

  • Selection pressure analysis:

    • Calculate dN/dS ratios to detect selection

    • Identify sites under positive selection

    • Map selection patterns to protein structure

    • Correlate with predicted functional regions

  • Comparative genomics:

    • Analyze synteny (gene order conservation)

    • Examine operon structure across species

    • Compare with M. tuberculosis Rv0497 equivalent

    • Assess presence/absence patterns in pathogenic vs. environmental mycobacteria

This evolutionary approach complements functional studies by highlighting conserved features that likely play important roles in protein function, as has been demonstrated in mycobacterial comparative genomics studies.

How can I develop an in vitro assay system for testing Mb0508 activity if its function is unknown?

Developing functional assays for uncharacterized proteins requires creative approaches:

  • Activity prediction-based assays:

    • Based on structural similarities to characterized proteins

    • Test for enzymatic activities common in the protein family

    • Examine potential co-factor binding

    • Screen against common substrates

  • Binding assays:

    • Surface plasmon resonance with potential ligands

    • Thermal shift assays to detect stabilizing molecules

    • Pull-down experiments to identify binding partners

    • Fluorescence polarization for small molecule interactions

  • Cellular phenotype assays:

    • Complement knockout strains with wild-type or mutant Mb0508

    • Measure growth under various stress conditions

    • Assess impact on specific cellular pathways

    • Monitor changes in gene expression profiles

  • High-throughput screening approaches:

    • Yeast two-hybrid against prey libraries

    • Phage display to identify binding peptides

    • Small molecule microarrays to find interacting compounds

    • CRISPR interference to identify genetic interactions

For entirely uncharacterized proteins like Mb0508, a combined approach starting with broad predictions and progressively narrowing to specific hypotheses has proven most successful, similar to research approaches used for other uncharacterized mycobacterial proteins .

What are the optimal storage and handling conditions for recombinant Mb0508?

Based on product information, optimal storage and handling includes:

  • Storage recommendations:

    • Store at -20°C for regular storage

    • Use -80°C for extended storage

    • Working aliquots can be kept at 4°C for up to one week

    • Store in Tris-based buffer with 50% glycerol as optimized for this protein

  • Stability considerations:

    • Avoid repeated freeze-thaw cycles (create single-use aliquots)

    • Protein can withstand room temperature for a week without losing activity based on similar recombinant protein testing

    • Can withstand four cycles of freeze and thaw without losing activity

  • Buffer optimization:

    • Standard buffer: 20 mM MOPS, 300 mM NaCl, 1 mM EDTA, 2 mM DTT

    • Consider adding protease inhibitors if degradation is observed

    • Low protein concentrations may benefit from carrier proteins (BSA 0.2-1%)

  • Quality control:

    • Periodically verify activity after storage

    • Monitor for precipitation or aggregation

    • Check purity by SDS-PAGE

    • Validate using activity assays when possible

These recommendations align with standard practices for recombinant protein handling and the specific guidance provided for recombinant Mb0508 .

What controls should I include when designing experiments with Mb0508?

Proper experimental controls are crucial for research with uncharacterized proteins:

  • Expression and purification controls:

    • Empty vector control (expression without Mb0508 gene)

    • Tag-only control (expression of tag without Mb0508)

    • Known protein control (well-characterized protein of similar size)

    • Degradation control (intentionally denatured Mb0508)

  • Functional assay controls:

    • Negative control (buffer only)

    • Positive control (known protein with similar predicted function)

    • Heat-inactivated Mb0508

    • Specificity controls (unrelated proteins)

  • Interaction study controls:

    • Tag-only pull-down

    • Unrelated protein with same tag

    • Pre-cleared lysates

    • Competition controls with excess untagged protein

  • In vivo study controls:

    • Wild-type strain (no modification)

    • Empty vector complementation

    • Complementation with known gene

    • Heterologous expression controls

These controls align with standard practices in molecular biology research and should be adapted based on the specific experimental design, similar to approaches used in studying other uncharacterized proteins .

How can I validate antibodies against Mb0508 for research applications?

Antibody validation is critical for reliable research results:

  • Initial characterization:

    • Western blot against recombinant Mb0508

    • Test against lysates from M. bovis expressing/not expressing Mb0508

    • Pre-absorption with recombinant protein to confirm specificity

    • Cross-reactivity testing against related proteins

  • Application-specific validation:

    • For immunoprecipitation: verify pull-down efficiency

    • For immunofluorescence: compare with GFP-fusion localization

    • For ELISA: establish standard curves with recombinant protein

    • For flow cytometry: compare with knockout controls

  • Validation criteria:

    ApplicationPrimary Validation MethodSecondary ValidationMinimum Acceptance Criteria
    Western blotSingle band at expected MWKnockout control>90% reduction in knockout
    ImmunofluorescenceColocalization with GFP fusionPeptide competition>85% signal reduction
    ChIPqPCR of known targetsKnockout control>10-fold enrichment vs. IgG
    ELISATitration curveSpike-in recoveryCV <15%, recovery 80-120%
  • Documentation:

    • Record all validation experiments

    • Note batch number and storage conditions

    • Document optimal working dilutions

    • Specify validated applications

Proper antibody validation is essential for reproducible research and aligns with best practices in immunological research with mycobacterial proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.