Recombinant Uncharacterized protein Mb0898c (Mb0898c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BQ2027_MB0898C; Uncharacterized protein Mb0898c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB0898C
Target Protein Sequence
MRIGVGVCTTPDARQAAVEAAGQARDELAGEAPSLAVLLGSRAHTDRAADVLSAVLQMID PPALVGCIAQAIVAGRHEIEDEPAVVVWLASGLAAETFQLDFVRTGSGALITGYRFDRTA RDLHLLLPDPYTFPSNLLIEHPNTDLPGTAVVGGVVSGGRRRGDTRLFRDHDVLTSGVVG VRLPGMRGVPVVSQGCRPIGYPYIVTGADGILITELGGRPPLQRLREIVEGLSPDERALV SHGLQIGIVVDEHLAAPGQGDFVIRGLLGADPSTGSIEIDEVVQVGATMQFQVRDAAGAD KDLRLTVERAAARLPGRAAGALLFTCNGRGRRMFGVADHDASTIEELLGGIPLAGFFAAG EIGPIAGRNALHGFTASMALFVDDME
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mb0898c and what organism does it come from?

Mb0898c is an uncharacterized protein derived from Mycobacterium bovis. It is classified as a conserved hypothetical protein with 386 amino acids and has a corresponding ortholog in Mycobacterium tuberculosis designated as Rv0874c . The protein is identified in the UniProt database under the accession number P0A5D4, indicating its recognition in protein databases despite its uncharacterized nature .

How should recombinant Mb0898c be stored for optimal stability?

For optimal stability, recombinant Mb0898c should be stored at -20°C/-80°C. It is recommended to aliquot the protein upon receipt to avoid repeated freeze-thaw cycles, which can compromise protein integrity and activity. Working aliquots can be stored at 4°C for up to one week. The protein is typically lyophilized and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 50% is recommended for long-term storage at -20°C/-80°C .

What are the optimal expression systems for producing recombinant Mb0898c?

E. coli is the preferred expression system for recombinant Mb0898c due to its efficiency and cost-effectiveness. The protein is typically expressed with an N-terminal His tag to facilitate purification. When expressing in E. coli BL21(DE3), induction is usually performed with 1mM IPTG when the OD600 reaches 0.5-0.6, with expression carried out at 30°C for 4 hours. This approach typically yields sufficient quantities of soluble protein for research purposes .

What purification strategies are most effective for Mb0898c?

The most effective purification strategy for Mb0898c involves nickel-NTA affinity chromatography, taking advantage of the His-tag fused to the protein. After cell lysis by sonication (typically 50 cycles of 10 seconds, 40% duty cycle), the clarified lysate is applied to a nickel-NTA column, followed by washing steps and elution with buffer containing 500mM imidazole. This approach typically yields protein with >90% purity as determined by SDS-PAGE. For applications requiring higher purity, additional chromatography steps such as size exclusion chromatography may be employed .

How can I verify the identity and purity of purified Mb0898c?

To verify the identity and purity of purified Mb0898c, a multi-method approach is recommended:

  • SDS-PAGE analysis: To assess purity and approximate molecular weight (expected ~34 kDa with the His-tag)

  • Western blot: Using anti-His antibodies to confirm the presence of the His-tagged protein

  • Mass spectrometry: For definitive molecular weight determination and protein identification

  • Protein sequencing: N-terminal sequencing to confirm protein identity

Additionally, immunological verification can be performed using antibodies against M. bovis proteins to confirm antigenic properties, as demonstrated in previous studies where western blot analysis showed good immunogenicity of both LpxC and GmhA recombinant proteins from bacterial pathogens .

How should I design experiments to investigate the potential function of Mb0898c?

When investigating the potential function of an uncharacterized protein like Mb0898c, a systematic experimental approach is recommended:

  • Bioinformatic analysis: Use tools like BLAST, Pfam, and protein structure prediction software to identify potential functional domains and homologous proteins with known functions.

  • Protein-protein interaction studies: Employ yeast two-hybrid screens, pull-down assays, or co-immunoprecipitation to identify interacting partners that might provide functional clues.

  • Cellular localization: Use fluorescent protein tagging or immunofluorescence to determine the subcellular localization of Mb0898c, which can provide insights into its function.

  • Gene knockout/knockdown: Generate knockout or knockdown strains of M. bovis lacking Mb0898c to observe phenotypic changes.

  • Complementation studies: Reintroduce the Mb0898c gene into knockout strains to confirm phenotypic rescue.

The experimental design should incorporate appropriate controls and follow a two-group experimental design with treatment and control groups to establish causality between the protein's presence and observed phenotypes 16.

What are appropriate positive and negative controls for immunological studies using recombinant Mb0898c?

For immunological studies using recombinant Mb0898c, the following controls are recommended:

Positive controls:

  • Inactivated whole M. bovis cells as a complete antigen source

  • Known immunogenic proteins from M. bovis with established immune responses

  • Previously validated recombinant proteins with similar expression and purification methods

Negative controls:

  • Phosphate-buffered saline (PBS) with adjuvant but no protein

  • Irrelevant recombinant protein expressed and purified under identical conditions

  • Pre-immune serum for antibody response studies

In mouse model studies, like those conducted for other bacterial proteins, separate control groups should be maintained to establish baseline responses and specific effects attributable to the protein .

How should I formulate research questions when studying Mb0898c?

When formulating research questions for Mb0898c studies, follow these methodological principles:

  • Ensure relevance: The question should address meaningful gaps in our understanding of mycobacterial proteins.

  • Make it manageable: Limit the scope to aspects that can be realistically investigated with available resources.

  • Ensure appropriateness: The question should be logically and scientifically suitable for the research community and institution.

  • Focus and clarity: Research questions must be specific enough to be well-covered in available space and resources.

  • Complexity: Questions should not be answerable with a simple "yes" or "no" but require comprehensive research and analysis.

  • Measurability: The process should produce data that can be supported or contradicted through experimental evidence.

For example, instead of asking "What does Mb0898c do?", a better formulated question would be "What role does Mb0898c play in the pathogenicity of M. bovis infection, and how does its expression profile change during different stages of host infection?"

How can I design a study to evaluate the immunoprotective potential of Mb0898c?

To evaluate the immunoprotective potential of Mb0898c, design a randomized controlled study following these methodological steps:

  • Protein preparation: Express and purify recombinant Mb0898c to >90% purity as confirmed by SDS-PAGE.

  • Animal model selection: Choose an appropriate animal model (typically mice for initial studies). For example, use female KM mice (18-22g) with 10 animals per group.

  • Immunization protocol:

    • Group 1: Recombinant Mb0898c (100 μg/100 μL) mixed with Freund's adjuvant

    • Group 2: Inactivated M. bovis (4.0 × 10^9 CFU/100 μL)

    • Group 3: Negative control (PBS with adjuvant)

    • Additional groups may include other proteins of interest for comparison

  • Immunization schedule: Primary immunization followed by a booster dose after 2 weeks, both administered subcutaneously.

  • Sample collection: Collect serum at 2 weeks post-primary immunization and 2 weeks post-booster.

  • Immune response assessment:

    • Measure antibody (IgG) titers using ELISA

    • Assess cytokine profiles (IL-4, IL-10, IFN-γ) to determine Th1/Th2 balance

    • Perform whole blood bactericidal assays

  • Challenge studies: Challenge immunized animals with virulent M. bovis and monitor survival, clinical symptoms, and bacterial burden.

  • Statistical analysis: Compare protection rates between groups using appropriate statistical methods.

This approach follows established methodologies used in similar studies for other bacterial proteins, where protection rates of 40-60% have been observed .

What techniques can be used to resolve structural features of Mb0898c despite its uncharacterized nature?

To resolve the structural features of Mb0898c, employ the following advanced techniques:

Combining multiple techniques provides complementary structural information and increases confidence in the final structural model .

How can I investigate potential post-translational modifications of Mb0898c?

Investigating post-translational modifications (PTMs) of Mb0898c requires a comprehensive analytical approach:

  • Mass spectrometry-based strategies:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) after proteolytic digestion

    • Top-down proteomics for intact protein analysis

    • Targeted multiple reaction monitoring (MRM) for specific modifications

  • Specific PTM detection techniques:

    • Phosphorylation: ProQ Diamond staining, phospho-specific antibodies, Phos-tag gels

    • Glycosylation: Periodic acid-Schiff (PAS) staining, lectin affinity chromatography

    • Ubiquitination/SUMOylation: Western blotting with specific antibodies

  • Enrichment strategies for specific PTMs:

    • Immobilized metal affinity chromatography (IMAC) for phosphopeptides

    • Hydrazide chemistry for glycopeptides

    • Antibody-based enrichment for acetylation, methylation

  • Bioinformatic prediction:

    • Use algorithms like NetPhos, NetOGlyc, NetNGlyc to predict potential modification sites

    • Compare predictions with experimental data

  • Site-directed mutagenesis:

    • Mutate predicted modification sites and assess functional consequences

    • Compare wild-type and mutant proteins in functional assays

For recombinant Mb0898c expressed in E. coli, note that certain PTMs (especially eukaryotic-specific ones) may be absent. For a complete PTM profile, consider expression in alternative hosts like mammalian or insect cells that can provide many of the post-translational modifications necessary for correct protein folding or activity .

What approaches can be used to identify potential orthologs of Mb0898c across different mycobacterial species?

To identify potential orthologs of Mb0898c across different mycobacterial species, implement the following comprehensive approach:

  • Sequence-based homology searches:

    • BLAST (Basic Local Alignment Search Tool) searches against mycobacterial genomes

    • Position-Specific Iterative BLAST (PSI-BLAST) for detecting distant relationships

    • Hidden Markov Model (HMM) profiles for sensitive sequence similarity detection

  • Comparative genomics analysis:

    • Synteny analysis to examine gene order conservation

    • Analysis of genomic context and operonic structure

    • Investigation of conserved gene neighborhoods

  • Phylogenetic analysis:

    • Multiple sequence alignment of potential homologs

    • Construction of phylogenetic trees to infer evolutionary relationships

    • Reconciliation of gene trees with species trees to distinguish orthologs from paralogs

  • Structural comparison:

    • Prediction of protein structures for potential homologs

    • Structural alignment to identify conserved domains despite sequence divergence

    • Analysis of conserved structural motifs

  • Functional conservation assessment:

    • Comparison of predicted functional domains

    • Analysis of conserved active sites or binding motifs

    • Experimental validation of functional equivalence

From the search results, we already know that Mb0898c has an ortholog in Mycobacterium tuberculosis designated as Rv0874c, which is classified as an "Identical, conserved hypothetical" protein . This suggests high conservation and potential functional importance across mycobacterial species.

What are common challenges in expressing recombinant Mb0898c and how can they be addressed?

Common challenges in expressing recombinant Mb0898c and their solutions include:

  • Protein insolubility/inclusion body formation:

    • Lower the expression temperature (try 16-20°C)

    • Reduce inducer concentration (0.1-0.5 mM IPTG instead of 1 mM)

    • Use solubility-enhancing fusion tags (SUMO, MBP, TrxA)

    • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

    • Optimize codon usage for the expression host

  • Low expression levels:

    • Try different expression vectors with stronger promoters

    • Optimize codon usage for E. coli

    • Use specialized E. coli strains (Rosetta, CodonPlus) to supply rare tRNAs

    • Extend induction time or adjust cell density at induction

  • Protein degradation:

    • Include protease inhibitors during purification

    • Use E. coli strains lacking specific proteases (BL21)

    • Optimize buffer composition and pH

    • Add stabilizing agents (glycerol, reducing agents)

  • Purification difficulties:

    • Optimize imidazole concentration in wash and elution buffers

    • Try different affinity tags if His-tag purification is problematic

    • Implement multiple chromatography steps

    • Adjust buffer conditions to prevent aggregation

  • Loss of activity during storage:

    • Aliquot protein to avoid freeze-thaw cycles

    • Add stabilizers like trehalose (6%) to lyophilized preparations

    • Store in appropriate buffer conditions with glycerol

    • Consider flash-freezing with liquid nitrogen .

How can I design experiments to determine if Mb0898c has enzymatic activity?

To investigate potential enzymatic activity of Mb0898c, follow this systematic approach:

  • Bioinformatic prediction of potential activities:

    • Search for conserved catalytic motifs or domains

    • Compare with enzymes of known function

    • Use tools like BLAST, Pfam, InterPro, and enzyme prediction servers

  • General activity screenings:

    • Test for common enzymatic activities (hydrolase, transferase, oxidoreductase)

    • Use colorimetric or fluorometric substrate libraries

    • Monitor changes in pH, temperature, or co-factor requirements

  • Specific activity assays based on predictions:

    • Design assays based on bioinformatic predictions

    • Include appropriate substrates, co-factors, and reaction conditions

    • Use positive controls with known enzymes of similar predicted function

  • Enzyme kinetics characterization:

    • If activity is detected, determine kinetic parameters (Km, Vmax, kcat)

    • Test substrate specificity

    • Investigate effects of pH, temperature, and inhibitors

  • Structure-function analysis:

    • Perform site-directed mutagenesis of predicted catalytic residues

    • Correlate structural features with enzymatic function

    • Use pH and temperature dependence to infer catalytic mechanism

  • Experimental design considerations:

    • Include appropriate negative controls (heat-inactivated protein, buffer-only)

    • Use positive controls (well-characterized enzymes)

    • Perform replicates for statistical validity

    • Test under various conditions (pH, temperature, salt concentration)

This methodical approach has been successful in characterizing previously uncharacterized proteins and can be applied to investigate Mb0898c's potential enzymatic functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.