Recombinant Uncharacterized protein Mb0909 (Mb0909)

Shipped with Ice Packs
In Stock

Description

Protein Identification and Genomic Context

UniProt ID: P0A5D6
Gene Locus: Mb0909 (Ordered locus name)
Gene Synonym: BQ2027_MB0909
Organism: Mycobacterium bovis (bovine tuberculosis pathogen)

This 340-amino-acid protein is annotated as a conserved hypothetical membrane protein with predicted multi-pass transmembrane domains . No direct homologs with experimentally validated functions have been identified in closely related species like M. tuberculosis.

Table 1: Key Sequence Characteristics

FeatureDetails
Amino Acid Length340 residues
Molecular Weight39.8 kDa
Isoelectric Point (pI)Not experimentally determined (UniProt: computational data unavailable)
DomainsNo conserved domains beyond generic transmembrane motifs
Post-Translational ModificationsNone reported

The N-terminal sequence (residues 1-20):
MDRTRIVRRWRRNMDVADDAE

Recombinant Production Details

While functional studies are absent, this recombinant protein is utilized in:

  • Antigen Characterization: Potential use in serological assays for bovine TB diagnostics .

  • Structural Biology: Membrane protein crystallization trials (predicted α-helical regions) .

  • Comparative Genomics: Studying genomic differences between M. bovis and M. tuberculosis .

Challenges and Limitations

  • Functional Unknowns: No enzymatic activity or interaction partners have been empirically validated .

  • Structural Predictions: Computational models suggest transmembrane topology but lack experimental validation (e.g., cryo-EM) .

  • Commercial Availability: Sold primarily as research-grade material without functional guarantees .

Future Directions

Priority research areas include:

  1. Knockout Studies: Assessing phenotypic changes in M. bovis ΔMb0909 strains.

  2. Immunogenicity Screens: Testing antibody reactivity in TB-infected hosts.

  3. Structural Resolution: Solving 3D structures to infer functional motifs.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BQ2027_MB0909; Uncharacterized protein Mb0909
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB0909
Target Protein Sequence
MDRTRIVRRWRRNMDVADDAEYVEMLATLSEGSVRRNFNPYTDIDWESPEFAVTDNDPRW ILPATDPLGRHPWYQAQSRERQIEIGMWRQANVAKVGLHFESILIRGLMNYTFWMPNGSP EYRYCLHESVEECNHTMMFQEMVNRVGADVPGLPRRLRWVSPLVPLVAGPLPVAFFIGVL AGEEPIDHTQKNVLREGKSLHPIMERVMSIHVAEEARHISFAHEYLRKRLPRLTRMQRFW ISLYFPLTMRSLCNAIVVPPKAFWEEFDIPREVKKELFFGSPESRKWLCDMFADARMLAH DTGLMNPIARLVWRLCKIDGKPSRYRSEPQRQHLAAAPAA
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Uncharacterized protein Mb0909?

Recombinant Uncharacterized protein Mb0909 (Mb0909) is a protein of Mycobacterium bovis origin that currently lacks full functional characterization. It consists of 340 amino acids with the sequence beginning with MDRTRIV and is designated by UniProt ID P0A5D6 . The protein is classified as "hypothetical" because its physiological functions within M. bovis have not been definitively established through experimental validation. Recombinant versions of this protein are produced in various expression systems for research purposes, typically maintaining ≥85% purity as determined by SDS-PAGE analysis .

What are the common expression systems used for Mb0909 production?

The recombinant Mb0909 protein can be expressed in multiple host systems, each offering different advantages depending on research requirements. Common expression platforms include E. coli, yeast, baculovirus-infected insect cells, mammalian cells, and cell-free expression systems . E. coli remains the most widely used for initial characterization due to its cost-effectiveness and high yield, while mammalian expression systems may be preferred when post-translational modifications are essential for functional studies. Cell-free expression systems offer advantages for proteins that may be toxic to host cells or require rapid production timelines .

What is the optimal storage protocol for Mb0909 recombinant protein?

The optimal storage conditions for maintaining Mb0909 stability include storage at -20°C or -80°C (the latter preferred for extended storage) in a buffer containing Tris and 50% glycerol optimized specifically for this protein . Research indicates that repeated freeze-thaw cycles significantly reduce protein activity and integrity, so aliquoting the protein upon receipt is strongly recommended. For ongoing experiments, working aliquots can be stored at 4°C for up to one week without significant degradation, though activity should be validated before critical experiments .

What analytical techniques are recommended for verifying Mb0909 purity and integrity?

For comprehensive characterization of recombinant Mb0909, multiple analytical techniques should be employed in sequence. SDS-PAGE analysis provides initial purity assessment, typically confirming ≥85% purity for commercial preparations . For higher resolution analysis, researchers should supplement with size exclusion chromatography to detect aggregates and Western blotting with tag-specific or custom Mb0909 antibodies to confirm identity. Mass spectrometry (particularly LC-MS/MS) provides definitive identification and can detect possible post-translational modifications or truncations. Circular dichroism spectroscopy is valuable for secondary structure assessment, particularly before functional studies, to confirm proper protein folding .

How can researchers assess the correct folding of recombinant Mb0909?

Assessing proper folding of recombinant Mb0909 requires a multi-technique approach since its native function remains uncharacterized. Circular dichroism (CD) spectroscopy provides initial indication of secondary structure elements, while thermal shift assays (differential scanning fluorimetry) can evaluate stability and potential ligand interactions. Size exclusion chromatography can identify aggregation states that often indicate misfolding. Additionally, research on recombinant proteins indicates that misfolded proteins typically induce specific stress responses in host cells, including changes in proteins involved in lipid metabolism and oxidative stress . Therefore, monitoring expression host responses during production can provide indirect evidence of folding states.

What is known about the structural domains of Mb0909?

The Mb0909 protein (340 amino acids) has not been fully characterized structurally, but bioinformatic analysis of its sequence suggests several noteworthy features. The N-terminal region (amino acids 1-50) contains multiple arginine residues, including "MDRTRIVRR" and "WRRNMDVADD," suggesting potential DNA/RNA binding capabilities . The central region contains sequences consistent with transmembrane or membrane-associated domains, particularly "PLVPLVAGPLPVAFFIGVLAGEEPIDH." Secondary structure prediction algorithms indicate a mix of alpha-helical and beta-sheet regions throughout the protein. While crystallographic data is not currently available, homology modeling against related mycobacterial proteins suggests Mb0909 may function in regulatory pathways, potentially as a transcription factor or membrane-associated regulatory protein .

What are the comparative advantages of different expression systems for Mb0909?

Expression SystemAdvantagesDisadvantagesTypical YieldRecommended Applications
E. coliHigh yield, cost-effective, rapid growth, well-established protocolsLimited post-translational modifications, potential inclusion body formation10-50 mg/LInitial characterization, structural studies, antibody production
YeastEukaryotic post-translational modifications, secretion possible, high density culturesLonger expression time, glycosylation patterns differ from mammalian cells5-20 mg/LFunctional studies requiring basic eukaryotic modifications
Baculovirus/InsectComplex eukaryotic modifications, proper folding of complex proteinsTechnical complexity, longer production time, higher cost1-10 mg/LFunctional studies requiring authentic folding
Mammalian cellsNative-like post-translational modifications, authentic foldingHighest cost, lowest yield, technical expertise required0.5-5 mg/LStudies requiring mammalian-specific modifications
Cell-free expressionRapid production, suitable for toxic proteins, direct incorporation of modified amino acidsLower yield, higher reagent cost, limited post-translational modifications0.1-1 mg/mL reactionRapid screening, proteins toxic to living cells

Each expression system should be selected based on the specific research requirements, with E. coli being recommended for initial studies and structural characterization of Mb0909, while mammalian systems may be necessary for functional studies if post-translational modifications prove critical .

What purification strategy yields the highest purity for Mb0909?

A multi-step purification strategy is recommended for achieving high-purity Mb0909 preparations. For His-tagged constructs, the optimal protocol begins with immobilized metal affinity chromatography (IMAC) using Ni-NTA resins under native conditions (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10-20 mM imidazole for binding; 250-300 mM imidazole for elution). This should be followed by size exclusion chromatography to remove aggregates and impurities of different molecular weights. For highest purity (>95%), an ion exchange chromatography step can be added depending on the protein's theoretical isoelectric point. Final dialysis into storage buffer containing 50% glycerol has been shown to maintain stability. This approach consistently yields preparations with ≥85% purity as determined by SDS-PAGE, suitable for most research applications .

How can researchers optimize soluble expression of Mb0909 to avoid inclusion bodies?

Optimizing soluble expression of Mb0909 requires addressing several parameters that influence protein folding during expression. Research on recombinant proteins indicates that lowering induction temperature (16-20°C) significantly reduces inclusion body formation by slowing protein synthesis and allowing proper folding . For Mb0909 specifically, using lower IPTG concentrations (0.1-0.2 mM) for induction in E. coli systems and harvesting at OD600 of 0.6-0.8 before induction improves solubility. Co-expression with chaperones (particularly GroEL/GroES or DnaK/DnaJ/GrpE systems) can further enhance proper folding. Additionally, fusion tags beyond the standard His-tag, such as SUMO or MBP, have demonstrated improved solubility for difficult proteins. If inclusion bodies persist, optimizing lysis buffer conditions with mild detergents (0.1% Triton X-100) and increased salt concentration (500 mM NaCl) can help solubilize the protein during extraction .

What functional assays can be used to investigate the potential role of Mb0909?

Although Mb0909 remains uncharacterized, several functional assays can be employed to investigate its potential biological roles based on sequence analysis predictions. For potential DNA/RNA binding activity (suggested by its arginine-rich regions), electrophoretic mobility shift assays (EMSA) using genomic fragments or predicted binding sequences can be performed. Protein-protein interaction studies using pull-down assays, yeast two-hybrid screening, or proximity labeling methods can identify binding partners that may indicate function. If membrane association is suspected (based on hydrophobic regions), liposome binding assays and subcellular fractionation in native Mycobacterium bovis can assess membrane localization. Enzymatic activity screens, particularly those related to cell wall biosynthesis pathways common in mycobacteria, may reveal unexpected functions. Finally, gene knockout or knockdown studies in M. bovis followed by phenotypic characterization provide the most direct evidence of biological function .

How can researchers generate specific antibodies against Mb0909 for immunological studies?

Generating high-quality antibodies against Mb0909 requires careful antigen design and validation strategies. For polyclonal antibodies, using the full-length recombinant protein (≥85% purity) for immunization yields broad epitope recognition, though specificity may be compromised. A more targeted approach involves selecting 2-3 immunogenic epitopes from hydrophilic, surface-exposed regions of Mb0909 (preferably 15-20 amino acids) predicted by algorithms like Bepipred or ABCpred. For monoclonal antibodies, mice immunization with either full-length protein or KLH-conjugated peptides, followed by hybridoma screening against recombinant Mb0909, is recommended. Critical validation steps include Western blotting against both recombinant protein and native M. bovis lysates, ELISA for sensitivity determination, and pre-adsorption tests to confirm specificity. Immunoprecipitation experiments further validate antibody utility for interaction studies. Cross-reactivity with other mycobacterial species should be assessed, particularly with M. tuberculosis homologs .

How can researchers address protein degradation issues during Mb0909 purification?

Addressing Mb0909 degradation requires a systematic approach targeting multiple potential causes. Protease inhibition is critical during initial extraction - a comprehensive protease inhibitor cocktail containing PMSF (1 mM), EDTA (1 mM), leupeptin (10 μg/mL), and aprotinin (10 μg/mL) should be used freshly in all buffers. Temperature control throughout purification (maintaining 4°C) significantly reduces proteolytic activity. Buffer optimization can further protect Mb0909 - increasing buffer pH to 8.0-8.5 (if compatible with downstream applications) and adding stabilizing agents like 5-10% glycerol, 100-200 mM NaCl, and 1-5 mM DTT or 2-mercaptoethanol has been shown to enhance stability. For persistent degradation issues, faster purification protocols using higher flow rates and immediate aliquoting and freezing post-purification is recommended. If C-terminal degradation is specifically observed (common in recombinant proteins), moving affinity tags from N-terminal to C-terminal positions can help identify intact protein during purification .

What strategies can overcome poor antibody recognition of Mb0909?

Poor antibody recognition of Mb0909 can result from multiple factors that require specific troubleshooting approaches. If epitope masking by protein folding is suspected, mild denaturation conditions (0.1% SDS or 2M urea) can improve epitope accessibility without complete protein unfolding. For recombinant Mb0909 with tags, epitope steric hindrance can be addressed by using longer linker sequences between the tag and protein or by tag removal through protease cleavage. If antibody affinity is the issue, optimizing primary antibody concentration through titration experiments (testing 0.1-10 μg/mL range) and extending incubation times (overnight at 4°C) often improves detection. For Western blotting applications specifically, more efficient protein transfer using optimized buffer systems (adding 0.1% SDS to transfer buffer for hydrophobic proteins) and longer transfer times improves detection of problematic proteins. If all else fails, epitope retrieval methods adapted from immunohistochemistry, such as brief heat treatment of membranes in citrate buffer (pH 6.0), can sometimes recover recognition of difficult epitopes .

How can researchers address solubility issues when working with purified Mb0909?

Addressing solubility issues with purified Mb0909 requires buffer optimization strategies based on the protein's biophysical properties. First, screening multiple buffer systems is recommended, testing HEPES (pH 7.5), Tris-HCl (pH 8.0), and phosphate buffers (pH 7.2) to identify optimal pH conditions. Adding solubility enhancers can dramatically improve stability - glycerol (10-20%), glucose (5%), sucrose (5-10%), or arginine (50-100 mM) act as chemical chaperones preventing aggregation. For proteins with hydrophobic regions (as predicted for Mb0909), mild non-ionic detergents below their critical micelle concentration (0.01-0.05% Triton X-100 or 0.01% NP-40) can maintain solubility without denaturing the protein. Studies on recombinant proteins indicate that ionic strength optimization (typically 150-300 mM NaCl) is critical for stability, with too little or excessive salt promoting aggregation . For severe solubility issues, fusion partners that remain after purification (particularly MBP or SUMO) significantly enhance solubility, though they may impact functional studies .

How can researchers use Mb0909 as a model system for studying protein misfolding and aggregation?

Mb0909 presents an excellent model system for studying protein misfolding and aggregation phenomena due to its structural complexity and expression characteristics. Research on recombinant proteins has demonstrated that misfolding and aggregation induce specific host cell responses, including changes in proteins involved in lipid metabolism, oxidative stress responses, and membrane permeability . To utilize Mb0909 in such studies, researchers should establish controlled misfolding conditions by modulating expression temperature, inducer concentration, and chaperone availability. Comparative proteomics between cells expressing properly folded versus misfolded Mb0909 can identify stress response pathways. Aggregation kinetics can be monitored using thioflavin T binding assays, dynamic light scattering, and electron microscopy to characterize aggregate morphology. Interestingly, research indicates that native recombinant protein and large insoluble aggregates may induce different cellular responses than misfolded protein and soluble aggregates, making Mb0909 valuable for studying these distinctions .

What approaches can identify potential interaction partners of Mb0909 in mycobacterial systems?

Identifying Mb0909 interaction partners requires a multi-pronged approach combining in vitro and in vivo techniques. Affinity purification-mass spectrometry (AP-MS) using tagged Mb0909 as bait represents the most comprehensive approach, ideally performed in native Mycobacterium bovis or related mycobacterial expression systems. For validation of specific interactions, bacterial two-hybrid systems adapted for mycobacteria offer advantages over yeast systems due to more relevant cellular environments. Proximity-dependent biotin identification (BioID) or APEX2 proximity labeling, though technically challenging in bacterial systems, can capture transient interactions by expressing Mb0909 fused to biotin ligase in mycobacterial hosts. For membrane-associated interactions (suggested by Mb0909 sequence features), split-ubiquitin membrane yeast two-hybrid systems can be employed. Computational approaches, including interactome prediction based on co-expression data from mycobacterial transcriptome studies and structural docking with predicted mycobacterial proteins, can guide experimental approaches. Final validation should include co-immunoprecipitation with antibodies against native proteins and functional studies of identified complexes .

What are the major knowledge gaps in understanding Mb0909 function?

Despite available recombinant Mb0909 protein resources, significant knowledge gaps persist that limit understanding of its biological role. Foremost is the absence of verified functional annotation - the protein remains "uncharacterized" or "hypothetical" without experimental confirmation of its activity . Gene expression context is poorly understood, including under which growth conditions or stress stimuli Mb0909 is expressed in M. bovis. Subcellular localization data is lacking, though sequence analysis suggests possible membrane association. Evolutionary conservation analysis across mycobacterial species is incomplete, which could provide functional insights through comparative genomics. Finally, while the amino acid sequence is known, three-dimensional structural information is entirely absent, limiting structure-based functional predictions. These knowledge gaps collectively prevent integration of Mb0909 into mycobacterial systems biology models and hamper potential exploitation for therapeutic or diagnostic applications in bovine tuberculosis research .

What novel technological approaches might accelerate functional characterization of Mb0909?

Emerging technologies offer promising avenues to accelerate Mb0909 functional characterization. CRISPR interference (CRISPRi) in mycobacterial systems allows precise downregulation of Mb0909 expression followed by phenotypic and transcriptomic profiling to reveal functional pathways. Single-cell RNA-seq of M. bovis under various stress conditions can identify co-expression networks placing Mb0909 in functional context. For protein-level analysis, thermal proteome profiling (TPP) can identify ligands and interaction partners in native-like conditions. Microfluidic approaches for high-throughput enzymatic activity screening against diverse substrate libraries might reveal unexpected catalytic functions. Advanced structural prediction using AlphaFold2 combined with molecular dynamics simulations can generate testable hypotheses about functional domains and binding pockets. Synthetic biology approaches, including testing Mb0909 function in heterologous mycobacterial species with defined knockout backgrounds, can isolate its role from compensatory pathways. Together, these approaches would overcome traditional limitations in studying hypothetical mycobacterial proteins .

How might Mb0909 research contribute to understanding mycobacterial pathogenesis?

Mb0909 research has potential to significantly advance understanding of mycobacterial pathogenesis through several avenues. If Mb0909 is confirmed to be involved in cell wall biosynthesis or remodeling (suggested by some sequence features), it could reveal novel aspects of mycobacterial cell envelope adaptations during infection, particularly important as the cell wall is a critical virulence determinant. As an uncharacterized protein potentially specific to pathogenic mycobacteria, Mb0909 may represent an undiscovered virulence mechanism not present in non-pathogenic species. Comparative studies between M. bovis and M. tuberculosis homologs could illuminate host-specificity determinants - why M. bovis infects cattle while M. tuberculosis preferentially infects humans. If Mb0909 proves immunogenic, it may serve as a novel biomarker for distinguishing M. bovis infection from other mycobacterial infections in cattle. From a therapeutic perspective, if functional studies reveal Mb0909 to be essential for mycobacterial survival or virulence, it could represent a new drug target for bovine tuberculosis control with potential translation to human tuberculosis applications .

What cell-based assays are most appropriate for investigating Mb0909 function?

For investigating Mb0909 function in cellular contexts, several specialized assays are particularly appropriate. Macrophage infection models using bovine macrophages infected with wild-type versus Mb0909-deficient M. bovis strains can reveal roles in host-pathogen interactions through comparative transcriptomics, cytokine profiling, and bacterial survival quantification. Complementation studies reintroducing Mb0909 variants in knockout strains help map critical functional domains. For potential roles in cell wall processes, mycobacterial reporter strains with cell wall stress-responsive promoters driving fluorescent protein expression can detect perturbations when Mb0909 expression is modulated. Bacterial two-hybrid screening in mycobacterial surrogate hosts can identify interaction partners in a native-like environment. If membrane association is confirmed, fluorescent protein fusions in live cell imaging can track localization during different growth phases and stress conditions. Finally, conditional expression systems using tetracycline-regulated promoters controlling Mb0909 expression allow temporal analysis of essentiality and function under defined conditions .

What comparative genomics approaches can help predict Mb0909 function?

Comprehensive comparative genomics approaches can provide crucial insights into potential Mb0909 functions. Phylogenetic profiling across multiple mycobacterial species and strains, particularly comparing pathogenic versus non-pathogenic species, can reveal evolutionary conservation patterns correlating with specific phenotypes. Synteny analysis examining the genomic neighborhood of Mb0909 across species may identify functionally related genes based on conserved operon structures. Domain architecture analysis using tools like InterProScan and Pfam can identify cryptic functional domains not apparent in basic sequence searches. Codon usage analysis can indicate if Mb0909 is highly expressed or regulated at the translational level. Co-evolution analysis identifying genes with similar evolutionary histories may reveal functional relationships. Structural homology searches using predicted 3D models rather than sequence alone can identify distant structural relatives with known functions. Integration of these approaches with mycobacterial transcriptomic data across growth conditions and infection models provides a systems biology perspective on potential Mb0909 functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.