Recombinant Uncharacterized protein Mb0921c (Mb0921c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BQ2027_MB0921C; Uncharacterized protein Mb0921c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-535
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB0921C
Target Protein Sequence
MSDHDRDFDVVVVGGGHNGLVAAAYLARAGLRVRLLERLAQTGGAAVSIQAFDGVEVALS RYSYLVSLLPSRIVADLGAPVRLARRPFSSYTPAPATAGRSGLLIGPTGEPRAAHLAAIG AAPDAHGFAAFYRRCRLVTARLWPTLIEPLRTREQARRDIVEYGGHEAAAAWQAMVDEPI GHAIAGAVANDLLRGVIATDALIGTFARMHEPSLMQNICFLYHLVGGGTGVWHVPIGGMG SVTSALATAAARHGAEIVTGADVFALDPDGTVRYHSDGSDGAEHLVRGRFVLVGVTPAVL ASLLGEPVAALAPGAQVKVNMVVRRLPRLRDDSVTPQQAFAGTFHVNETWSQLDAAYSQA ASGRLPDPLPCEAYCHSLTDPSILSARLRDAGAQTLTVFGLHTPHSVFGDTEGLAERLTA AVLASLNSVLAEPIQDVLWTDAQSKPCIETTTTLDLQRTLGMTGGNIFHGALSWPFADND DPLDTPARQWGVATDHERIMLCGSGARRGGAVSGIGGHNAAMAVLACLASRRKSP
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mb0921c and what organism does it originate from?

Mb0921c is an uncharacterized protein from Mycobacterium bovis (strain AF2122/97). While initially classified as "uncharacterized," functional analysis suggests it is a probable oxidoreductase (EC 1.-.-.-). The protein consists of 535 amino acids and shows 100% sequence identity with Rv0897c from Mycobacterium tuberculosis strain H37Rv. Bioinformatic analysis indicates similarity to various oxidoreductases from diverse organisms, including putative oxidoreductase from Streptomyces coelicolor, phytoene dehydrogenase from Aeropyrum pernix, and methoxyneurosporene dehydrogenase from Rhodobacter sphaeroides .

What expression systems are optimal for producing recombinant Mb0921c?

Current research indicates that E. coli is the most commonly used expression system for Mb0921c recombinant protein production. For optimal expression in E. coli, experimental design approaches can be implemented to maximize yields and solubility. Based on similar recombinant protein expression studies, a factorial design methodology allows researchers to evaluate multiple variables simultaneously and determine optimal culture conditions with fewer experiments .

Key parameters to optimize for Mb0921c expression include:

  • Induction temperature (typically 18-37°C)

  • IPTG concentration (0.1-1.0 mM)

  • Induction duration (4-6 hours has shown optimal productivity in similar systems)

  • Growth media composition

  • Cell density at induction (OD600)

A fractional factorial design (2^n-k) can be employed to systematically evaluate these variables while minimizing the number of required experiments .

How can I improve the solubility of recombinant Mb0921c during expression?

Improving soluble expression of Mb0921c requires optimization of several experimental conditions. Based on similar oxidoreductase expression studies, consider the following approaches:

  • Temperature reduction: Lowering the expression temperature to 16-25°C often increases solubility by slowing protein synthesis and allowing proper folding.

  • Co-expression with chaperones: Molecular chaperones like GroEL/GroES, DnaK, and trigger factor can assist in proper protein folding.

  • Media optimization: Using a multivariant experimental design approach to test different media compositions. For example:

    • Base media type (LB, TB, M9)

    • Carbon source concentration

    • Nitrogen source concentration

    • Trace elements and cofactors

  • Induction parameters: Optimizing IPTG concentration and induction timing. Lower IPTG concentrations (0.1-0.5 mM) and induction at higher cell densities may increase soluble expression.

  • Fusion tags: The N-terminal His-tag is commonly used for Mb0921c, but other solubility-enhancing tags (SUMO, MBP, Thioredoxin) might improve solubility .

Experimental design methods can reduce the required experiments while maximizing information about these variables and their interactions. For instance, a study examining similar recombinant protein expression achieved 250 mg/L of soluble protein with 75% homogeneity through systematic optimization .

What are the predicted functional domains in Mb0921c?

Based on sequence analysis and comparison with similar proteins, Mb0921c likely contains domains characteristic of oxidoreductases:

  • FAD/NAD(P)-binding domain: The N-terminal region contains the sequence motif GGGHNGL, which is typical of dinucleotide-binding domains found in many oxidoreductases.

  • Substrate-binding domain: The central region likely contains the substrate binding pocket and catalytic residues.

  • C-terminal dimerization domain: May be involved in protein-protein interactions or oligomerization.

Comparative analysis with homologous proteins suggests Mb0921c may function in electron transfer chains within mycobacterial metabolism. The protein shows significant similarity to phytoene dehydrogenase and methoxyneurosporene dehydrogenase, suggesting a potential role in isoprenoid metabolism or related redox pathways in Mycobacterium bovis .

How does the protein structure of Mb0921c relate to its potential function?

While the detailed three-dimensional structure of Mb0921c has not been fully elucidated, its classification as a probable oxidoreductase and sequence homology analysis provides insights into structure-function relationships:

The protein would fold into a three-dimensional structure that brings catalytic residues into proper orientation for electron transfer reactions. The GGGHNGL sequence and other conserved motifs throughout the protein create binding pockets for cofactors like FAD or NAD(P), which would be essential for its oxidoreductase activity .

What are the optimal storage and handling conditions for recombinant Mb0921c?

Based on the available product information, the following storage and handling guidelines are recommended for maintaining recombinant Mb0921c stability and activity:

ParameterRecommendation
Storage temperature-20°C to -80°C for long-term storage
Working storage4°C for up to one week
Buffer compositionTris-based buffer with 50% glycerol, pH 8.0
Freeze-thaw cyclesMinimize repeated freeze-thaw cycles
ReconstitutionReconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL
AliquotingPrepare small working aliquots to avoid repeated freeze-thaw cycles

For extended experiments, it's advisable to add glycerol (final concentration 5-50%) and prepare small aliquots for storage at -20°C or -80°C .

What analytical methods are most appropriate for studying Mb0921c enzymatic activity?

Since Mb0921c is classified as a probable oxidoreductase, several analytical approaches can be employed to characterize its enzymatic activity:

  • Spectrophotometric assays: Monitor absorbance changes associated with cofactor reduction/oxidation:

    • NAD(P)H oxidation (340 nm)

    • Cytochrome c reduction (550 nm)

    • Artificial electron acceptors like DCPIP or ferricyanide

  • Oxygen consumption measurements: Using oxygen electrodes or fluorescence-based oxygen sensors to monitor oxygen-dependent reactions.

  • Coupled enzyme assays: Linking Mb0921c activity to more easily detectable enzymatic reactions.

  • HPLC or LC-MS analysis: For characterizing substrate conversion and product formation.

  • Isothermal titration calorimetry (ITC): To study binding thermodynamics with potential substrates and cofactors.

When designing these assays, consider testing various electron donors/acceptors and substrates based on the predicted function and homology to known oxidoreductases like phytoene dehydrogenase .

How can experimental design approaches be applied to characterize Mb0921c function?

To systematically characterize the function of Mb0921c, a multivariant experimental design approach is highly recommended:

  • Fractional factorial design: This approach allows efficient screening of multiple factors that might affect Mb0921c activity, including:

    • pH range (typically 5.0-9.0)

    • Temperature range (20-50°C)

    • Various cofactors (NAD(P)H, FAD, FMN)

    • Potential substrates based on homologous enzymes

    • Metal ion requirements

  • Response surface methodology (RSM): After identifying significant factors from initial screening, RSM can be used to optimize conditions and understand interactions between factors affecting enzyme activity.

  • Design matrix example:
    For initial screening, a Plackett-Burman design can efficiently test multiple factors with minimal experiments:

    ExperimentpHTemp (°C)[NAD(P)H][Metal ion][Substrate]Buffer
    16.025HighHighLowType A
    28.025LowHighHighType B
    36.037LowLowHighType A
    .....................

This experimental design methodology allows for systematic investigation with fewer experiments while yielding statistically significant insights into the protein's function and optimal reaction conditions .

What approaches can resolve the discrepancy between predicted and observed functions of Mb0921c?

When investigating discrepancies between bioinformatically predicted and experimentally observed functions of Mb0921c, consider these methodological approaches:

  • Comprehensive substrate screening:

    • Design a substrate library based on metabolic pathways in Mycobacterium

    • Include substrates of homologous enzymes (phytoene, carotenoid precursors)

    • Employ high-throughput screening methods to test activity against diverse substrates

  • Structure-guided functional analysis:

    • Generate homology models based on structurally characterized homologs

    • Identify putative active site residues

    • Perform site-directed mutagenesis of these residues and assess impact on activity

  • Metabolomic approaches:

    • Compare metabolome profiles of wild-type and Mb0921c knockout strains

    • Identify metabolites that accumulate or deplete in the absence of Mb0921c

  • Protein-protein interaction studies:

    • Identify interaction partners using pull-down assays or yeast two-hybrid screens

    • Map the enzyme to specific metabolic pathways based on its interaction network

  • Heterologous expression complementation:

    • Express Mb0921c in systems with defined mutations in oxidoreductases

    • Assess functional complementation to identify analogous activities

These approaches can be implemented sequentially or in parallel using factorial design principles to efficiently resolve functional ambiguities .

How does Mb0921c compare to its homolog Rv0897c from M. tuberculosis?

Mb0921c from Mycobacterium bovis shares 100% sequence identity with Rv0897c from Mycobacterium tuberculosis strain H37Rv across the entire 535 amino acid sequence. This perfect conservation suggests critical functional importance in both pathogenic mycobacterial species .

The functional conservation implies:

  • Evolutionary significance: The absolute sequence conservation indicates strong evolutionary pressure to maintain this protein's exact structure and function.

  • Potential virulence role: The conservation between these pathogenic mycobacteria suggests potential involvement in processes related to pathogenicity or survival within hosts.

  • Functional redundancy: Both proteins are annotated as probable oxidoreductases, with similar predicted substrate specificities and catalytic mechanisms.

  • Research applicability: Findings from studies on either protein can likely be applied interchangeably, allowing researchers to leverage the broader research base on M. tuberculosis proteins when studying M. bovis.

Additionally, both proteins show similarity to other mycobacterial proteins (Rv1432, Rv2997, and Rv3829c from M. tuberculosis), suggesting they belong to a family of related oxidoreductases that may have evolved through gene duplication events .

What methods can determine if Mb0921c is structurally and functionally similar to other bacterial oxidoreductases?

To systematically investigate structural and functional similarities between Mb0921c and other bacterial oxidoreductases, researchers can employ these methodological approaches:

  • Computational methods:

    • Sequence alignment and phylogenetic analysis to establish evolutionary relationships

    • Homology modeling using crystallized bacterial oxidoreductases as templates

    • Molecular docking studies with potential substrates and cofactors

    • Molecular dynamics simulations to compare binding pocket dynamics

  • Biochemical characterization:

    • Parallel activity assays using identical conditions across multiple bacterial oxidoreductases

    • Substrate specificity profiling to identify overlapping or distinct preferences

    • Inhibitor sensitivity patterns to probe active site similarities

    • Cofactor requirements and kinetic parameter comparison

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM to determine the three-dimensional structure

    • Circular dichroism spectroscopy to compare secondary structure elements

    • Limited proteolysis to identify similar domain organizations and flexible regions

    • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

  • Functional complementation:

    • Cross-species complementation studies in knockout/knockdown models

    • Expression of Mb0921c in heterologous systems with defined oxidoreductase mutations

These approaches should be implemented systematically, with results analyzed using appropriate statistical methods to quantify the degree of structural and functional similarity between Mb0921c and other characterized bacterial oxidoreductases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.