Recombinant Uncharacterized protein Mb1311c (Mb1311c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
BQ2027_MB1311C; Uncharacterized protein Mb1311c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-591
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB1311C
Target Protein Sequence
MADRGQRRGCAPGIASALRASFQGKSRPWTQTRYWAFALLTPLVVAMVLTGCSASGTQLE LAPTADRRAAVGTTSDINQQDPATLQDGGNLRLSLTDFPPNFNILHIDGNNAEVAAMMKA TLPRAFIIGPDGSTTVDTNYFTSIELTRTAPQVVTYTINPEAVWSDGTPITWRDIASQIH AISGADKAFEIASSSGAERVASVTRGVDDRQAVVTFAKPYAEWRGMFAGNGMLLPASMTA TPEAFNKGQLDGPGPSAGPFVVSALDRTAQRIVLTRNPRWWGARPRLDSITYLVLDDAAR LPALQNNTIDATGVGTLDQLTIAARTKGISIRRAPGPSWYHFTLNGAPGSILADKALRLA IAKGIDRYTIARVAQYGLTSDPVPLNNHVFVAGQDGYQDNSGVVAYNPEQAKRELDALGW RRSGAFREKDGRQLVIRDLFYDAQSTRQFAQIAQHTLAQIGVKLELQAKSGSGFFSDYVN VGAFDIAQFGWVGDAFPLSSLTQIYASDGESNFGKIGSPQIDAAIERTLAELDPGKARAL ANQVDELIWAEGFSLPLTQSPGTVAVRSTLANFGATGLADLDYTAIGFMRR
Uniprot No.

Target Background

Protein Families
Bacterial solute-binding protein 5 family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

How is recombinant Mb1311c protein typically produced for research purposes?

Recombinant Mb1311c is typically produced by heterologous expression in E. coli with an N-terminal His-tag . The methodology follows these key steps:

  • Cloning: The full-length gene (encoding amino acids 1-591) is PCR-amplified and cloned into an expression vector containing an N-terminal His-tag.

  • Transformation and Expression: The recombinant plasmid is transformed into an E. coli expression strain and induced using appropriate conditions (typically IPTG for T7-based systems).

  • Purification: The protein is purified using nickel affinity chromatography, taking advantage of the His-tag.

  • Quality Control: SDS-PAGE analysis is performed to confirm purity (>90% is typically considered acceptable for initial characterization studies) .

  • Storage: The purified protein is often lyophilized and can be reconstituted in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . For long-term storage, aliquoting with 50% glycerol and storage at -20°C/-80°C is recommended to avoid repeated freeze-thaw cycles.

What bioinformatic tools can provide initial insights into Mb1311c function?

For initial functional annotation of uncharacterized proteins like Mb1311c, researchers typically employ multiple complementary bioinformatic approaches:

Analysis TypeRecommended ToolsPurpose
Domain IdentificationInterProScan, SMART, HMMER, NCBI CDARTIdentify conserved protein domains
Motif AnalysisMotif, PROSITEDetect functional motifs and patterns
Signal Peptide PredictionSignalPPredict presence and location of signal peptides
Transmembrane Region AnalysisTMHMM, PhobiusPredict transmembrane helices
Homology DetectionBLASTp, HHpredIdentify distant homologs with known functions
Gene Ontology AssignmentInterProScan, Blast2GOAssign GO terms for molecular function, biological process, and cellular component
Phylogenetic AnalysisMEGA, IQ-TREEExamine evolutionary relationships with characterized proteins

The average accuracy and ROC area of combined prediction approaches can reach approximately 83.6% and 0.90, respectively, as demonstrated in studies on other uncharacterized proteins .

What experimental approaches are most effective for determining the function of uncharacterized proteins like Mb1311c?

Determining the function of uncharacterized proteins requires a multi-faceted approach combining computational predictions with experimental validation:

  • Protein-Protein Interaction Studies:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity-dependent biotin identification (BioID)

    • STRING analysis to predict interaction partners based on genomic context

  • Gene Expression Analysis:

    • RNA-seq to identify co-expressed genes under various conditions

    • Diurnal expression pattern analysis to identify potential involvement in light-dependent processes (as demonstrated for other uncharacterized proteins)

    • qRT-PCR to validate expression patterns under specific conditions

  • Gene Disruption and Phenotypic Analysis:

    • CRISPR-Cas9 gene knockout or knockdown

    • Transposon mutagenesis

    • Conditional expression systems

    • Phenotypic screening under various stress conditions

  • Structural Biology Approaches:

    • X-ray crystallography

    • Cryo-electron microscopy

    • NMR spectroscopy for smaller domains

    • Small-angle X-ray scattering (SAXS) for solution structure

  • Biochemical Characterization:

    • Enzymatic activity assays based on predicted functions

    • Substrate screening

    • Binding assays with predicted ligands

    • Post-translational modification analysis

For Mb1311c specifically, given its presence in a pathogenic organism (M. bovis), investigating its role in host-pathogen interactions and virulence would be particularly valuable.

How can homology modeling and structural prediction enhance our understanding of Mb1311c?

Homology modeling and structural prediction are crucial for uncharacterized proteins and can provide significant insights even when experimental structures are unavailable:

Structures with TM scores below 0.5 compared to existing PDB entries might indicate that Mb1311c possesses a novel fold, which would make its structural characterization particularly valuable to the scientific community .

What is the potential role of Mb1311c in Mycobacterium bovis pathogenicity?

The potential role of Mb1311c in M. bovis pathogenicity can be investigated through multiple approaches:

  • Virulence Prediction:
    Computational tools like VICMPred and VirulentPred can be used to assess whether Mb1311c has characteristics typical of virulence factors . Similar analyses of uncharacterized proteins in other pathogens have successfully identified novel virulence factors.

  • Comparative Genomics:

    • Examining presence/absence patterns across pathogenic and non-pathogenic mycobacterial species

    • Analyzing sequence conservation and selection pressure

    • Investigating genomic context and organization near the Mb1311c gene

  • Expression Analysis During Infection:

    • Transcriptomic analysis of M. bovis during macrophage infection

    • qRT-PCR validation of expression changes during different stages of infection

    • Proteomics to confirm protein-level expression during infection

  • Host Response Studies:

    • Analyzing host immune response to recombinant Mb1311c

    • Testing for interference with host immune signaling pathways

    • Examining effects on host cell viability and function

  • Subcellular Localization:
    Transmembrane proteins, especially outer membrane proteins of gram-negative bacteria, often function as virulence factors and help pathogens evade host defense mechanisms . Determining whether Mb1311c is membrane-associated would provide clues about its potential role in pathogenesis.

What approaches can be used to investigate post-translational modifications (PTMs) of Mb1311c?

Investigating PTMs of uncharacterized proteins is crucial for understanding their regulation and function:

  • Mass Spectrometry-Based Detection:

    • Bottom-up proteomics using tryptic digestion followed by LC-MS/MS

    • Top-down proteomics for intact protein analysis

    • Multiple reaction monitoring (MRM) for targeted analysis of predicted modification sites

    • Electron transfer dissociation (ETD) for preserving labile modifications

  • PTM-Specific Enrichment Methods:

    • Phosphopeptide enrichment using titanium dioxide (TiO2) or immobilized metal affinity chromatography (IMAC)

    • Glycopeptide enrichment using lectin affinity chromatography

    • Ubiquitination analysis using ubiquitin remnant motif antibodies

  • Bioinformatic Prediction:

    PTM TypePrediction ToolsPurpose
    PhosphorylationNetPhos, GPSPredicts Ser/Thr/Tyr phosphorylation sites
    GlycosylationNetNGlyc, NetOGlycPredicts N- and O-linked glycosylation sites
    LipidationGPS-LipidPredicts various lipid modification sites
    Proteolytic CleavageSignalP, ProPPredicts signal peptide and propeptide cleavage sites
  • Biochemical Validation:

    • Phosphatase treatment followed by mobility shift analysis

    • Glycosidase treatment to confirm glycosylation

    • Site-directed mutagenesis of predicted modification sites

  • Functional Impact Assessment:

    • Comparing activity of modified vs. unmodified protein

    • Analyzing subcellular localization changes due to modifications

    • Examining protein-protein interaction differences with/without modifications

How can evolutionary conservation analysis contribute to understanding Mb1311c function?

Evolutionary conservation analysis is a powerful approach to infer functional importance and can be particularly valuable for uncharacterized proteins like Mb1311c:

  • Conservation Across Mycobacterial Species:
    Analyzing the conservation pattern of Mb1311c across pathogenic and non-pathogenic mycobacteria can provide insights into its potential role in virulence or core cellular functions.

  • Identification of Conserved Domains:
    Conservation often varies across a protein sequence, with functional domains showing higher conservation. Studies of uncharacterized proteins have demonstrated that identification of conserved unknown proteins across species can be highly informative .

  • Rate of Evolution Analysis:

    • Ka/Ks ratio calculation to determine selection pressure

    • Identification of rapidly evolving sites potentially involved in host-pathogen interactions

    • Detection of highly conserved sites likely critical for protein function

  • Phylogenetic Profiling:

    • Generating co-occurrence patterns of Mb1311c with proteins of known function

    • Identifying gene neighborhoods and operonic structures

    • Analysis of gene fusion events that may suggest functional relationships

  • Deep Green Analysis Approach:
    Research on other uncharacterized proteins has employed the "Deep Green" methodology to identify conserved uncharacterized proteins across species. This approach found that approximately 60% of such genes may have important fundamental roles in cellular functions . A similar analysis for Mb1311c could place it in functional context.

What are the optimal buffer conditions for working with recombinant Mb1311c?

Optimizing buffer conditions is critical for maintaining protein stability and function:

  • Storage Buffer Recommendations:

    • Tris/PBS-based buffer with 6% trehalose, pH 8.0

    • Addition of 50% glycerol for long-term storage at -20°C/-80°C

    • Aliquoting to avoid repeated freeze-thaw cycles

  • Reconstitution Protocol:

    • Centrifugation of lyophilized protein vial before opening

    • Reconstitution to 0.1-1.0 mg/mL in deionized sterile water

    • Gentle mixing to ensure complete solubilization

  • Buffer Screening for Structural Studies:

    Buffer TypepH RangeAdditives to Consider
    Phosphate6.5-7.5NaCl (50-300 mM)
    Tris7.5-8.5Glycerol (5-10%)
    HEPES7.0-8.0Reducing agents (DTT, TCEP)
    MES5.5-6.5Divalent cations (Mg2+, Ca2+)
  • Stability Optimization:

    • Thermal shift assays (Thermofluor) to identify stabilizing buffer conditions

    • Dynamic light scattering to monitor aggregation state

    • Size exclusion chromatography to assess oligomeric state under different conditions

  • Activity Preservation:
    While the specific activity of Mb1311c remains unknown, maintaining native-like conformation is essential. Consider testing different pH values, salt concentrations, and additives to preserve structural integrity for functional studies.

What are the challenges in crystallizing uncharacterized proteins like Mb1311c for structural studies?

Crystallizing uncharacterized proteins presents unique challenges that require specialized approaches:

  • Initial Screening Strategies:

    • Sparse matrix screening using commercial kits (Hampton Research, Molecular Dimensions)

    • Microseeding to overcome nucleation barriers

    • Utilization of trace fluorescent labeling to detect microcrystals

    • Grid screening around initial hits

  • Surface Engineering for Crystallizability:

    • Surface entropy reduction mutagenesis to replace flexible, solvent-exposed residues with alanines

    • Removal of predicted disordered regions that may impede crystal formation

    • Creation of fusion constructs with crystallization chaperones (T4 lysozyme, MBP)

  • Alternative Crystallization Approaches:

    • Lipidic cubic phase (LCP) for membrane proteins or membrane-associated proteins

    • Incomplete factorial design for systematic exploration of crystallization space

    • Counter-diffusion methods for generating quality crystals

  • Addressing Post-Crystallization Challenges:

    • Crystal optimization through additive screening

    • Dehydration protocols to improve diffraction quality

    • Heavy atom derivatization for experimental phasing

  • Non-Crystallographic Alternatives:
    If crystallization proves particularly challenging, consider:

    • Cryo-electron microscopy for larger assemblies

    • NMR for smaller domains

    • Small-angle X-ray scattering (SAXS) for solution structure

How can CRISPR-Cas9 be applied to study the function of Mb1311c in Mycobacterium bovis?

CRISPR-Cas9 technology has revolutionized genetic manipulation in mycobacteria and can be applied to study Mb1311c:

  • Knockout Strategy Design:

    • Selection of guide RNAs targeting Mb1311c using mycobacteria-optimized algorithms

    • Design of repair templates for precise gene deletion or replacement

    • Inclusion of selectable markers for efficient screening

  • CRISPR Delivery Options:

    • Non-integrative plasmids for transient Cas9 and sgRNA expression

    • Integrative vectors for stable expression in slow-growing mycobacteria

    • Phage-based delivery systems for improved efficiency

  • Phenotypic Characterization Approaches:

    • Growth kinetics under various conditions

    • Macrophage infection and survival assays

    • Guinea pig or mouse infection models

    • Transcriptomic and proteomic profiling of knockout strains

  • Complementation Studies:

    • Reintroduction of wild-type Mb1311c to confirm phenotype reversal

    • Introduction of mutated versions to identify critical residues

    • Controlled expression systems to assess dosage effects

  • CRISPRi for Essential Genes:
    If Mb1311c proves essential, CRISPR interference (CRISPRi) using catalytically inactive Cas9 (dCas9) can be employed for gene repression rather than deletion, allowing controlled study of essential genes.

What are the best practices for designing protein-protein interaction studies to identify Mb1311c binding partners?

Identifying protein-protein interactions is crucial for understanding the function of uncharacterized proteins:

  • Pull-Down Assays with Recombinant Mb1311c:

    • Expression of His-tagged Mb1311c as bait

    • Incubation with mycobacterial cell lysates

    • Affinity purification followed by mass spectrometry identification

    • Validation of interactions by reciprocal pull-downs

  • Yeast Two-Hybrid Screening:

    • Construction of Mb1311c bait fusion with DNA-binding domain

    • Screening against M. bovis genomic library fused to activation domain

    • Confirmation of positive interactions by plasmid rescue and retransformation

    • Elimination of false positives through stringent selection conditions

  • Proximity-Dependent Labeling in Native Context:

    • BioID or TurboID fusion to Mb1311c expressed in mycobacteria

    • Biotinylation of proximal proteins in living cells

    • Streptavidin purification and mass spectrometry identification

    • Validation through co-localization studies

  • Computational Prediction and Validation:

    • STRING database analysis to predict potential interactors

    • Structural docking studies with predicted partners

    • Co-expression analysis to identify functionally related proteins

    • Conservation of gene neighborhoods across mycobacterial species

  • Membrane-Specific Approaches (if Mb1311c is membrane-associated):

    • Split-ubiquitin yeast two-hybrid for membrane proteins

    • Chemical cross-linking followed by mass spectrometry

    • Blue native PAGE for intact membrane protein complexes

What is the potential significance of Mb1311c research for tuberculosis disease understanding?

Mycobacterium bovis is closely related to M. tuberculosis, the causative agent of human tuberculosis, making Mb1311c research potentially significant for TB understanding:

  • Comparative Genomics Insights:

    • Investigating orthologs of Mb1311c in M. tuberculosis and other mycobacterial pathogens

    • Analyzing conservation and divergence patterns across the Mycobacterium genus

    • Assessing potential roles in species-specific pathogenicity mechanisms

  • Host-Pathogen Interaction Studies:

    • Determining whether Mb1311c interacts with host immune components

    • Investigating potential immunomodulatory effects

    • Exploring recognition by host pattern recognition receptors

  • Drug Target Assessment:

    • Evaluating essentiality under various growth conditions

    • Structure-based virtual screening if structural data becomes available

    • Testing susceptibility of Mb1311c deletion mutants to existing antibiotics

  • Diagnostic Potential:

    • Evaluating Mb1311c as a biomarker for mycobacterial infection

    • Developing antibody-based detection methods

    • Exploring potential for species-specific diagnosis

  • Vaccine Development Applications:
    If Mb1311c proves immunogenic and surface-exposed, it might have potential as a vaccine component or target for immune-based therapies.

How can transcriptomic and proteomic data be integrated to better understand the biological context of Mb1311c?

Multi-omics integration provides a comprehensive view of protein function within cellular networks:

  • Co-Expression Network Analysis:

    • Constructing gene co-expression networks from RNA-seq data

    • Identifying modules containing Mb1311c to infer functional relationships

    • Correlation analysis with genes of known function

  • Condition-Specific Expression Profiling:
    Studies of other uncharacterized proteins have revealed important insights through diurnal expression analysis . For Mb1311c, similar analysis could include:

    • Expression patterns during infection cycles

    • Response to various stresses (oxidative, acidic, nutrient limitation)

    • Comparative expression in virulent vs. attenuated strains

  • Integrative Analysis Approaches:

    Data TypeIntegration MethodInsight Potential
    Transcriptomics + ProteomicsCorrelation analysisPost-transcriptional regulation
    Proteomics + MetabolomicsPathway enrichmentMetabolic functions
    Transcriptomics + ChIP-seqRegulatory network analysisTranscriptional regulation
  • Systems Biology Modeling:

    • Flux balance analysis to predict metabolic impacts

    • Boolean network modeling to understand regulatory effects

    • Bayesian network inference for causal relationship discovery

  • Temporal Analysis:

    • Time-course experiments during infection or stress response

    • Identifying early vs. late expression patterns

    • Detection of regulatory cascades involving Mb1311c

What computational resources are most valuable for researchers working with uncharacterized proteins like Mb1311c?

Several computational resources and tools are particularly valuable for researchers working with uncharacterized proteins:

  • Specialized Databases:

    • UniProt for comprehensive protein information and cross-references

    • Pfam for protein family classification

    • STRING for protein-protein interaction networks

    • KEGG for pathway mapping

  • Structure Prediction Platforms:

    • AlphaFold2 for state-of-the-art structure prediction

    • Swiss-Model for homology modeling

    • Phyre2 for fold recognition and modeling

    • I-TASSER for integrated structure prediction

  • Function Prediction Tools:

    • InterProScan for integrated domain and function prediction

    • HMMER for sensitive homology detection

    • BLAST and PSI-BLAST for sequence similarity searches

    • ConSurf for evolutionary conservation analysis

  • Specialized Analysis Pipelines:

    • ROC-based methodology for assessing prediction accuracy (demonstrated to achieve 83.6% accuracy in uncharacterized protein studies)

    • Deep Green approach for identification of conserved uncharacterized proteins

    • TM-score calculation for novel fold assessment

  • Visualization Tools:

    • PyMOL or UCSF Chimera for structural visualization

    • Cytoscape for network visualization and analysis

    • Interactive visualization tools for exploring 'People also ask' data about similar proteins

By combining these computational resources with experimental approaches, researchers can develop comprehensive strategies for characterizing the structure, function, and biological significance of Mb1311c.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.