Recombinant Uncharacterized protein Mb1321c (Mb1321c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are standardly accompanied by normal blue ice packs. For dry ice shipment, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage state, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
BQ2027_MB1321C; Uncharacterized protein Mb1321c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-521
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB1321C
Target Protein Sequence
MLQRSLGVNGRKLAMSARSAKRERKNASTAASKCYVVPPSARGWVHAYSVTATSMLNRRK AILDYLQGAVWVLPTFGVAIGLGSGAVLSMIPVKSGTLIDKLMFQGTPGDARGVLIVVSA TMITTIGIVFSLTVLSLQIASSQFSVRLLRTFLRDVPNQVVLAIFACTFAYSTGGLHTVG EHRDGGAFIPKVAVTGSLALAFVSIAALIYFLHHLMHSIQIDTIMDKVRLRTLGLVDQLY PESDTADRQVETPPSPPADAVPLLAPHSGYLQTVDVDDIAELAAASRYTALLVTFVGDYV TAGGLLGWCWRRGTAPGAPGSDFPQRCLRHVHIGFERTLQQDIRFGLRQMVDIALRALSP ALNDPYTAIQVVHHLSAVESVLASRALPDDVRRDRAGELLFWLPYPSFATYLHVGCAQIR RYGSREPLVLTALLQLLSAVAQNCVDPSRRVAVQTQIALVVRAAQREFADESDRAMVLGA AARATEVVERPGTLAPPPSTFGQVAAAQAAASTIRSADRDG
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Uncharacterized protein Mb1321c?

Recombinant Uncharacterized protein Mb1321c (UniProt ID: P0A5E4) is a full-length protein (521 amino acids) derived from Mycobacterium bovis. The protein is typically expressed in E. coli with an N-terminal His tag to facilitate purification and detection. Despite being uncharacterized, its conservation in mycobacterial species suggests potential functional significance in bacterial physiology or pathogenesis .

What are the basic storage conditions for Recombinant Mb1321c?

For optimal stability, Recombinant Mb1321c should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple uses. The lyophilized protein is typically reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol added as a cryoprotectant (50% being the standard concentration). Repeated freeze-thaw cycles should be avoided, and working aliquots can be maintained at 4°C for up to one week .

What expression systems are recommended for Mb1321c production?

While Mb1321c is commonly expressed in E. coli systems (as described in the available data), researchers should consider the following methodological approaches based on similar uncharacterized mycobacterial protein studies:

  • Bacterial Expression Systems:

    • BL21(DE3) or Rosetta strains for high-yield production

    • Optimization of induction conditions (IPTG concentration, temperature, duration)

    • Use of specialized vectors like pET series with T7 promoters

  • Alternative Expression Systems:

    • Mycobacterial expression systems for native folding

    • Cell-free expression systems for potentially toxic proteins

    • Yeast or mammalian systems for complex folding or post-translational modifications

The selection depends on research goals, required protein yield, and downstream applications .

What purification strategies are most effective for His-tagged Mb1321c?

For His-tagged Mb1321c, a multi-step purification approach is recommended:

  • Primary Affinity Chromatography:

    • Ni-NTA affinity chromatography under native or denaturing conditions

    • Imidazole gradient elution (typically 20-250 mM)

    • Buffer optimization to prevent protein aggregation

  • Secondary Purification (for higher purity):

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography based on predicted pI

    • Endotoxin removal for immunological studies

  • Quality Control:

    • SDS-PAGE analysis (>90% purity standard)

    • Western blot confirmation

    • Mass spectrometry validation

Careful buffer selection during purification can significantly impact final protein quality and stability .

What computational methods can predict Mb1321c structure?

As an uncharacterized protein, computational methods serve as valuable starting points for structural characterization:

  • Sequence-Based Predictions:

    • Secondary structure prediction (PSIPRED, JPred)

    • Transmembrane domain prediction (TMHMM, Phobius)

    • Disorder prediction (PONDR, IUPred)

  • 3D Structure Prediction:

    • Homology modeling if similar proteins exist

    • AlphaFold or RoseTTAFold for ab initio modeling

    • Molecular dynamics simulations to explore conformational dynamics

  • Function Prediction:

    • Conserved domain analysis (CDD, Pfam)

    • Binding site prediction (CASTp, fpocket)

    • Protein-protein interaction surfaces (PPI-Pred)

These computational approaches should guide subsequent experimental design rather than replace empirical structural studies .

Which experimental techniques are most suitable for Mb1321c structural characterization?

Based on approaches used for similar uncharacterized proteins:

  • X-ray Crystallography:

    • Crystallization screening optimization

    • Heavy atom derivatives for phase determination

    • Data collection at synchrotron facilities

  • NMR Spectroscopy:

    • 15N/13C labeling in minimal media

    • HSQC for folding assessment

    • Triple-resonance experiments for backbone assignment

  • Cryo-Electron Microscopy:

    • Especially valuable if Mb1321c forms larger complexes

    • Single-particle analysis workflow

    • High-resolution reconstruction

  • Limited Proteolysis:

    • Domain identification

    • Stable fragment isolation for crystallization

The choice depends on protein properties, available resources, and desired resolution .

How can immunological approaches be used to study Mb1321c function?

Multiple immunological approaches can provide functional insights:

  • Antibody Development:

    • Polyclonal antibodies against recombinant Mb1321c

    • Monoclonal antibodies targeting specific epitopes

    • Validation by Western blot and immunoprecipitation

  • Host Response Assessment:

    • Delayed-type hypersensitivity (DTH) reactions in animal models

    • Cytokine profiling (IFN-γ, IL-4, IL-10) after exposure

    • T-cell proliferation assays

  • Vaccination Approaches:

    • DNA vaccination with the gene encoding Mb1321c

    • Protein immunization with adjuvants

    • Evaluation of IgG1/IgG2a ratios as indicators of Th1/Th2 responses

These methods follow similar protocols to those used for other mycobacterial proteins like the CP24 from Brucella melitensis .

What cell-based assays can elucidate Mb1321c function?

Several cellular approaches can provide functional insights:

  • Localization Studies:

    • Fluorescently tagged protein expression

    • Subcellular fractionation

    • Immunoelectron microscopy

  • Interaction Studies:

    • Co-immunoprecipitation of binding partners

    • Yeast two-hybrid screening

    • Proximity labeling approaches (BioID, APEX)

  • Functional Assays:

    • Macrophage infection models

    • Growth complementation in knockout strains

    • Stress response assessment (pH, oxidative, nutrient limitation)

These cellular approaches can reveal physiological roles without prior functional knowledge .

How should researchers design experiments to characterize uncharacterized proteins like Mb1321c?

Systematic experimental design for uncharacterized proteins requires:

  • Hypothesis Generation:

    • Bioinformatic analysis for functional predictions

    • Genomic context analysis (operons, conserved neighborhoods)

    • Phylogenetic profiling across mycobacterial species

  • Multiple Baseline Design Approach:

    • Establish reliable baseline measurements before interventions

    • Implement staggered intervention points

    • Collect multiple data points to establish stability of observations

    • Use 3-4 baselines as recommended for robust experimental control

  • Controls and Validations:

    • Multiple negative controls (empty vector, unrelated protein)

    • Positive controls (related characterized protein)

    • Complementary methodologies for cross-validation

This approach helps establish causal relationships and enhances internal validity, similar to single-case experimental designs used in other research fields .

Experimental Design ComponentsImplementation for Mb1321c Research
Baseline MeasurementsProtein expression levels, growth rates, cellular responses
Intervention TypesGene knockout, protein overexpression, domain mutations
Data Collection PointsPre-intervention, multiple post-intervention timepoints
Minimum Baselines3-4 independent experimental conditions or biological replicates
Control TypesNegative (empty vector), Positive (characterized homolog), Technical

What are the key considerations for ensuring reproducibility in Mb1321c research?

Research reproducibility requires rigorous attention to:

  • Detailed Methodology Documentation:

    • Complete protein expression and purification protocols

    • Buffer compositions and storage conditions

    • Instrument settings and calibration procedures

  • Material Standardization:

    • Consistent protein batches (verified by quality control)

    • Validated reagents and antibodies

    • Genetically defined bacterial strains

  • Statistical Considerations:

    • Pre-determined sample sizes based on power analysis

    • Appropriate statistical tests for data analysis

    • Reporting of all replications, including unsuccessful attempts

  • Data Management:

    • Raw data preservation

    • Analysis script documentation

    • Metadata recording for all experiments

These practices align with established principles of experimental rigor in protein biochemistry and molecular biology research .

How can genetic manipulation techniques be used to study Mb1321c function?

Advanced genetic approaches include:

  • Gene Knockout/Knockdown:

    • CRISPR-Cas9 methods adapted for mycobacteria

    • Conditional expression systems (tetracycline-regulated)

    • Antisense RNA strategies

  • Reporter Systems:

    • Promoter-reporter fusions to study regulation

    • Protein-reporter fusions for localization and stability

    • Split-reporter systems for interaction studies

  • Complementation Analysis:

    • Wild-type complementation

    • Domain-specific complementation

    • Cross-species complementation with homologs

These techniques help establish essentiality and functional contributions of Mb1321c to bacterial physiology .

What high-throughput approaches could accelerate Mb1321c functional characterization?

Several omics approaches can provide functional insights:

  • Interactomics:

    • AP-MS (affinity purification-mass spectrometry)

    • Bacterial two-hybrid library screening

    • Protein microarrays

  • Transcriptomics:

    • RNA-seq comparing wild-type and knockout/overexpression strains

    • Ribosome profiling for translational impacts

    • Dual RNA-seq during host-pathogen interaction

  • Metabolomics:

    • Untargeted metabolic profiling

    • Stable isotope labeling

    • Flux analysis

  • Chemical Genomics:

    • Small molecule screening

    • Photo-crosslinking with activity-based probes

    • Fragment-based ligand discovery

These high-throughput approaches can rapidly generate hypotheses about protein function that can be validated through targeted follow-up studies .

How should researchers approach contradictory data in Mb1321c characterization?

When encountering contradictory results:

  • Systematic Error Identification:

    • Examine differences in experimental conditions

    • Assess reagent and sample quality

    • Review data collection and analysis methods

  • Integration Approaches:

    • Weigh evidence based on methodological strength

    • Consider biological context and constraints

    • Develop models that accommodate apparently contradicting observations

  • Resolution Strategies:

    • Design critical experiments to directly address contradictions

    • Employ orthogonal techniques for validation

    • Consider protein heterogeneity or multiple functional states

This systematic approach helps resolve apparent contradictions through deeper investigation rather than premature dismissal of data .

What bioinformatic tools are most useful for analyzing uncharacterized proteins like Mb1321c?

Several bioinformatic approaches yield valuable insights:

  • Sequence Analysis:

    • Multiple sequence alignment with homologs

    • Motif scanning (PROSITE, ELM)

    • Coevolution analysis (GREMLIN, EVcouplings)

  • Structure Analysis:

    • Secondary structure prediction

    • Fold recognition (threading)

    • Molecular dynamics simulations

  • Functional Prediction:

    • Gene Ontology term prediction

    • Pathway membership prediction

    • Protein-protein interaction network analysis

  • Integrated Analysis Platforms:

    • InterPro for combined protein signature analysis

    • STRING for functional association networks

    • I-TASSER for integrated structure-function prediction

These computational tools can guide wet-lab experiments by generating testable hypotheses about protein function .

What strategies address poor solubility or aggregation of recombinant Mb1321c?

For proteins with solubility challenges:

  • Expression Optimization:

    • Lower induction temperature (16-20°C)

    • Reduced inducer concentration

    • Co-expression with chaperones (GroEL/ES, DnaK/J)

  • Buffer Optimization:

    • Screening different pH conditions (typically pH 6.0-8.5)

    • Addition of solubility enhancers (glycerol, arginine, proline)

    • Inclusion of mild detergents for membrane-associated domains

  • Tag and Construct Design:

    • Alternative fusion tags (MBP, SUMO, Trx)

    • Domain-based constructs instead of full-length protein

    • Surface entropy reduction mutations

These approaches can significantly improve protein quality for downstream applications .

How can researchers address inconsistent or irreproducible results with Mb1321c?

When facing reproducibility challenges:

  • Critical Variable Identification:

    • Systematic variation of expression conditions

    • Lot-to-lot testing of critical reagents

    • Detailed protocol standardization

  • Quality Control Implementation:

    • Regular protein activity/integrity assays

    • Mass spectrometry verification

    • Circular dichroism for folding assessment

  • Experimental Design Improvements:

    • Increased biological and technical replicates

    • Inclusion of multiple positive and negative controls

    • Blinded analysis where applicable

Using a multiple baseline design approach can also strengthen experimental rigor by establishing stable baselines before interventions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.