Recombinant Uncharacterized protein Mb1377c (Mb1377c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag type, please inform us, and we will prioritize its implementation.
Synonyms
BQ2027_MB1377C; Uncharacterized protein Mb1377c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB1377C
Target Protein Sequence
MTAPETPAAQHAEPAIAVERIRTALLGYRIMAWTTGLWLIALCYEIVVRYVVKVDNPPTW IGVVHGWVYFTYLLLTLNLAVKVRWPLGKTAGVLLAGTIPLLGIVVEHFQTKEIKARFGL
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are commonly used for producing recombinant Mb1377c?

The most commonly documented expression system for Mb1377c is E. coli, though the protein can be expressed in various systems depending on research needs:

Expression SystemAdvantagesConsiderationsReported Purity
E. coliCost-effective, high yield, rapid expressionPotential improper folding of membrane proteins>90%
YeastBetter for complex proteins, more eukaryotic-like PTMsLonger production time, lower yield>85%
BaculovirusSuperior for membrane proteins, proper foldingComplex system, higher cost>85%
Mammalian CellsMost authentic PTMs, proper foldingHighest cost, longest production time>85%

The choice of expression system should be guided by the specific research objectives, particularly whether native conformation is critical for downstream applications .

What are the recommended reconstitution and storage conditions for Mb1377c?

For optimal stability and activity of recombinant Mb1377c, the following protocols are recommended:

Reconstitution Protocol:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimal: 50%)

  • Aliquot for long-term storage

Storage Conditions:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Store working aliquots at 4°C for up to one week

  • For long-term storage of reconstituted protein, store at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as they can compromise protein structure and activity

How can I design experiments to characterize the function of this uncharacterized protein?

A systematic approach to characterizing Mb1377c function would include:

  • Bioinformatic Analysis:

    • Sequence homology searches against characterized proteins

    • Structural prediction using tools like Phyre2 or I-TASSER

    • Transmembrane topology prediction

  • Expression System Selection:

    • Consider medium-throughput approaches to test multiple expression conditions

    • For membrane proteins like Mb1377c, test both E. coli and eukaryotic systems

  • Functional Characterization Strategy:

    • Generate knockout strains in M. bovis to observe phenotypic changes

    • Perform protein-protein interaction studies (pull-down assays, Y2H)

    • Conduct cellular localization experiments using fluorescent tags

  • Structural Studies Approach:

    • Attempt crystallization trials with various detergents if it's a membrane protein

    • Consider NMR for dynamic structural information

    • Use cryo-EM for larger complexes involving Mb1377c

Medium-scale structural genomics approaches as described by Busso et al. (2003) can be adapted for characterizing proteins like Mb1377c, with sequential and iterative procedures to optimize expression and solubility .

What protein engineering strategies can overcome expression limitations for Mb1377c?

For poorly expressed or insoluble proteins like membrane proteins, several protein engineering strategies can be employed:

  • Addition of Solubility-Enhancing Tags:

    • MBP (Maltose Binding Protein)

    • SUMO

    • Thioredoxin

  • Addition of Cleavable Pro-Sequences:

    • Implementing a furin protease-cleavable pro-sequence, similar to the approach used for TIMP-3 and TIMP-4

    • This can enhance secretion of difficult-to-express proteins

  • Co-expression with Chaperones:

    • GroEL/GroES

    • DnaK/DnaJ/GrpE systems

  • Domain Truncation:

    • Express soluble domains separately

    • Remove hydrophobic regions that may cause aggregation

  • Cell Engineering Combined with Protein Engineering:

    • Overexpression of processing enzymes like furin alongside the engineered target protein

    • This combined approach has been shown to enhance production of "difficult" recombinant targets

How can I design robust control experiments when studying Mb1377c?

Well-designed controls are essential for rigorous experimental design when working with uncharacterized proteins like Mb1377c:

  • Positive Controls:

    • Include a well-characterized protein from M. bovis with similar properties

    • For His-tagged purification, use a known His-tagged protein with established purification behavior

  • Negative Controls:

    • Empty vector controls for expression studies

    • Host cells without the recombinant protein

  • Experimental Control Design:

    • For knockout studies, include complementation experiments with the wild-type gene

    • For localization studies, include proteins with known localization patterns

  • Statistical Controls:

    • Conduct at least three independent biological replicates

    • Include technical replicates within each biological replicate

    • Apply appropriate statistical tests based on data distribution

How should I address purification challenges with recombinant Mb1377c?

Common purification challenges and solutions include:

ChallengePossible CausesSolutions
Low yieldPoor expression, protein degradationOptimize expression conditions, add protease inhibitors, reduce expression temperature
Poor purityNon-specific binding to resinIncrease imidazole in wash buffers, try different purification methods
Protein aggregationImproper folding, hydrophobic interactionsAdd detergents for membrane proteins, try refolding protocols
Loss of activityDenaturation during purificationMaintain cold temperatures, add stabilizing agents
PrecipitationBuffer incompatibilityScreen various buffer conditions, add stabilizing agents

For membrane proteins like Mb1377c, consider using mild detergents (e.g., DDM, CHAPS) throughout the purification process to maintain solubility and native structure .

How can I reliably interpret results when working with an uncharacterized protein?

When analyzing data from experiments with Mb1377c:

  • Establish Clear Baselines:

    • Compare to known proteins with similar properties

    • Use multiple analysis methods to confirm findings

  • Address Contradicting Results:

    • Evaluate experimental conditions that may cause discrepancies

    • Consider post-translational modifications or different protein conformations

    • Test reproducibility across different experimental systems

  • Validation Approaches:

    • Use orthogonal techniques to confirm findings (e.g., if a potential function is identified via in vitro assay, validate using genetic approaches)

    • Implement step-wedge experimental designs when evaluating interventions in complex systems

    • Apply interrupted time series designs when analyzing the effect of Mb1377c manipulation over time

  • Quantitative Analysis:

    • Use appropriate statistical tests based on sample distribution

    • Consider multiple hypothesis testing corrections when conducting numerous comparisons

    • Report effect sizes alongside p-values for better interpretation of biological significance

How can I design experiments to determine if Mb1377c is involved in M. bovis pathogenesis?

A comprehensive approach would include:

  • Gene Knockout/Knockdown Studies:

    • Generate Mb1377c deletion mutants (similar to csrR deletion approach in search result )

    • Compare virulence phenotypes between wild-type and mutant strains

    • Complement mutants with wild-type gene to confirm specificity

  • Expression Analysis During Infection:

    • Monitor Mb1377c expression during different stages of infection

    • Compare expression in different infection models and media conditions

  • Host-Pathogen Interaction Studies:

    • Investigate if Mb1377c interacts with host proteins

    • Test if antibodies against Mb1377c affect infection processes

  • Translational Reporter Systems:

    • Design GFP fusion constructs (similar to csrR-GFP reporters described in )

    • Monitor expression under various conditions mimicking host environments

These approaches should be implemented with appropriate controls and multiple biological replicates to ensure data reliability .

What inquiry-based approaches can advance understanding of Mb1377c function?

Adapting molecular biology laboratory education modules (MBLEMs) principles to Mb1377c research:

  • Bioinformatic Analysis Pipeline:

    • Sequence analysis for conserved domains

    • Structural predictions and modeling

    • Evolutionary analysis across mycobacterial species

  • Experimental Design Framework:

    • Clear hypothesis formulation about potential functions

    • Systematic variable testing (pH, temperature, ligands)

    • Integration of wet-lab experiments with computational approaches

  • Collaborative Research Approach:

    • Establish cross-disciplinary teams combining expertise in:

      • Biochemistry and structural biology

      • Microbiology and mycobacterial physiology

      • Bioinformatics and computational biology

  • Innovative Methodologies:

    • Apply CRISPR-based approaches for genome editing

    • Implement metagenomics to study Mb1377c homologs in related species

    • Use advanced imaging techniques to study cellular localization

By employing these inquiry-based approaches, researchers can systematically address the knowledge gaps surrounding this uncharacterized protein, potentially revealing important insights into M. bovis biology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.