Recombinant Uncharacterized protein Mb1392c (Mb1392c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it; we will prioritize its use in the manufacturing process.
Synonyms
BQ2027_MB1392C; Uncharacterized protein Mb1392c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB1392C
Target Protein Sequence
MDRCCQRATAFACALRPTKLIDYEEMFRGAMQARAMVANPDQWADSDRDQVNTRHYLSTS MRVALDRGEFFLVYQPIIRLADNRIIGAEALLRWEHPTLGTLLPGRFIDRAENNGLMVPL TAFVLEQACRHVRSWRDHSTDPQPFVSVNVSASTICDPGFLVLVEGVLGETGLPAHALQL ELAEDARLSRDEKAVTRLQELSALGVGIAIDDFGIGFSSLAYLPRLPVDVVKLGGKFIEC LDGDIQARLANEQITRAMIDLGDKLGITVTAKLVETPSQAARLRAFGCKAAQGWHFAKAL PVDFFRE
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Uncharacterized protein Mb1392c?

Recombinant Uncharacterized protein Mb1392c is a partially expressed, functionally unannotated protein derived from Mycobacterium bovis or related species. The full-length protein consists of 307 amino acids (residues 1-307) and can be expressed with various tags (commonly His-tag) in expression systems like E. coli for research purposes . The protein is typically used for studying biochemical properties, structural features, or potential roles in cellular processes, particularly in the context of mycobacterial pathogenesis.

What conserved domains or superfamilies have been identified in Mb1392c?

Bioinformatic analysis using tools like NCBI Conserved Domain Search Service (CDD) indicates that Mb1392c contains domains that belong to specific superfamilies. Similar hypothetical proteins from related Mycobacterium bovis strains have shown affiliations with superfamilies such as Beta_helix, Chalcone_N, GH113_mannanase-like, HDC_protein, M34_PPEP, PBECR3, Pectate_lyase_3, and SPASM . These domain identifications provide initial clues about potential functions, though experimental validation is required.

What are the optimal conditions for expressing recombinant Mb1392c?

For optimal expression of Mb1392c:

ParameterRecommended ConditionsRationale
Expression SystemE. coli BL21(DE3)Most commonly used for mycobacterial proteins
Induction0.5-1 mM IPTG at OD600 0.6-0.8Balance between yield and solubility
Temperature16-18°C post-inductionReduces inclusion body formation
Duration16-20 hoursMaximizes yield while maintaining quality
MediaTB or 2xYT with appropriate antibioticsProvides richer nutrient profile for higher yields

These conditions should be optimized for individual laboratory settings through small-scale expression trials before scaling up .

How can I improve the solubility of recombinant Mb1392c during expression?

To enhance Mb1392c solubility:

  • Reduce expression temperature to 16-18°C after induction

  • Use lower IPTG concentrations (0.1-0.5 mM)

  • Co-express with chaperones such as GroEL/GroES or DnaK/DnaJ/GrpE

  • Add solubility-enhancing tags like MBP (Maltose Binding Protein) or SUMO

  • Optimize lysis buffer conditions with mild detergents (0.1% Triton X-100)

  • Include osmolytes like glycerol (5-10%) or sorbitol (0.5 M) in buffers

  • Consider extracting from inclusion bodies using gentle solubilization with 2M urea followed by step-wise dialysis

These approaches should be tested systematically, documenting yield and quality metrics for each condition .

What purification strategy is most effective for His-tagged Mb1392c?

A multi-step purification approach is recommended:

  • Initial Capture: Nickel affinity chromatography using a linear imidazole gradient (20-250 mM)

  • Intermediate Purification: Ion exchange chromatography (consider the theoretical pI of Mb1392c)

  • Polishing Step: Size exclusion chromatography in a physiological buffer

Typical purification yields ≥85% purity as verified by SDS-PAGE. For structural studies requiring higher purity (>95%), additional polishing steps or specialized columns may be necessary.

How can I determine potential functions of Mb1392c as an uncharacterized protein?

A systematic approach to functional characterization should include:

  • Bioinformatic Analysis:

    • Sequence similarity searches against characterized proteins

    • Structure prediction using AlphaFold or ModBase

    • Genomic context analysis of neighboring genes

  • Biochemical Characterization:

    • Enzymatic activity screening based on predicted domains

    • Ligand binding assays (thermal shift assays or isothermal titration calorimetry)

    • Post-translational modification identification via mass spectrometry

  • Cellular Assays:

    • Gene knockout or knockdown studies in model mycobacteria

    • Protein localization studies using fluorescent tags

    • Protein-protein interaction studies (pull-down, yeast two-hybrid)

  • Structural Analysis:

    • X-ray crystallography or cryo-EM for 3D structure determination

    • Nuclear magnetic resonance (NMR) for dynamic structural information

This multi-faceted approach will provide complementary data to elucidate function .

How does Mb1392c potentially contribute to Mycobacterium bovis virulence?

While direct evidence for Mb1392c's role in virulence remains limited, its characterization can be approached through:

  • Virulence Correlation Analysis:

    • Compare expression levels between virulent and attenuated strains

    • Assess upregulation during infection using qRT-PCR

    • Examine protein abundance in different growth conditions

  • Host-Pathogen Interaction Studies:

    • Test for interaction with host immune factors

    • Evaluate impact on phagosome maturation in macrophage infection models

    • Assess influence on cytokine production profiles

  • Animal Model Studies:

    • Compare wildtype vs. Mb1392c knockout strains in appropriate animal models

    • Evaluate bacterial load, dissemination, and histopathology

    • Measure immune response differences

Initial bioinformatic analysis has not identified Mb1392c as having high homology with known virulence factors in the Virulence Factor Database (VFDB), suggesting it may have novel virulence mechanisms if it is indeed involved in pathogenesis .

How can I design experiments to resolve contradictory data about Mb1392c function?

When facing contradictory results:

  • Methodological Standardization:

    • Ensure protein quality consistency (purity assessments, activity assays)

    • Standardize experimental conditions (buffers, temperature, pH)

    • Use multiple technical and biological replicates

  • Multi-technique Validation:

    • Apply orthogonal techniques targeting the same biological question

    • Consider both in vitro and in vivo approaches

    • Use both targeted and untargeted methods (e.g., specific activity assays and proteomics)

  • Systematic Analysis of Variables:

    • Test protein from different expression conditions

    • Evaluate impact of tags/fusion partners on function

    • Assess activity under varying physiological conditions

  • Collaborative Cross-validation:

    • Engage multiple laboratories to validate key findings

    • Use standardized protocols and reagent sharing

    • Perform blinded analyses when appropriate

What crystallization strategies should I consider for structural determination of Mb1392c?

For successful crystallization:

Crystallization FactorRecommended Approach
Protein PreparationAchieve >95% purity; remove flexible tags; ensure monodispersity
Buffer OptimizationScreen various pH values (6.0-8.5) and salt concentrations
AdditivesTest glycerol, MPD, detergents, and metal ions as additives
Screening StrategyBegin with sparse matrix screens followed by optimization of promising conditions
TemperatureTest both 4°C and 20°C crystallization setups
Protein ConcentrationTry a range of 5-15 mg/mL depending on solubility
Crystallization MethodVapor diffusion (hanging/sitting drop) initially, followed by batch or LCP methods if needed

Consider using surface entropy reduction mutations or lysine methylation if initial crystallization attempts fail. For membrane-associated regions, detergent screening may be necessary .

How can I effectively compare Mb1392c with homologs in other mycobacterial species?

Comparative analysis should follow this workflow:

  • Sequence-based Comparisons:

    • Perform multiple sequence alignment of Mb1392c with homologs

    • Calculate sequence identity and similarity percentages

    • Identify conserved residues and motifs

  • Structural Comparisons:

    • Generate homology models based on crystallized homologs

    • Perform structural superposition and RMSD calculations

    • Compare electrostatic surface potentials

  • Functional Conservation Assessment:

    • Test biochemical activities across homologs using standardized assays

    • Compare substrate specificities and kinetic parameters

    • Evaluate cross-complementation in knockout models

  • Genomic Context Analysis:

    • Assess conservation of genomic neighborhood

    • Compare operon structures across species

    • Identify co-evolved gene clusters

This systematic comparison will reveal functional constraints and evolutionary adaptations, providing insights into Mb1392c's biological significance .

What computational tools are most appropriate for predicting the 3D structure of Mb1392c?

For structure prediction of Mb1392c, employ a hierarchical approach:

  • Template-based Methods:

    • SWISS-MODEL: When close homologs with known structures exist

    • I-TASSER: For integration of multiple threading approaches

    • Phyre2: For fold recognition and distant homology detection

  • Deep Learning Approaches:

    • AlphaFold2: Currently provides the most accurate ab initio structure predictions

    • RoseTTAFold: Complementary approach using different neural network architecture

  • Model Validation and Refinement:

    • MolProbity: For stereochemical quality assessment

    • PROCHECK: For Ramachandran plot analysis

    • FG-MD: For molecular dynamics-based refinement

  • Comparative Analysis:

    • Generate models using multiple methods and compare

    • Calculate GDT-TS scores between models to assess consensus

    • Use local quality estimators to identify reliable regions

Researchers should note that predicted structures require experimental validation, particularly for regions with low confidence scores .

How can I integrate Mb1392c research into broader mycobacterial systems biology studies?

Integration strategies include:

  • Network Analysis:

    • Construct protein-protein interaction networks including Mb1392c

    • Perform gene co-expression analysis across various conditions

    • Identify network motifs and potential functional modules

  • Multi-omics Integration:

    • Correlate Mb1392c expression/abundance with transcriptomic profiles

    • Analyze metabolomic changes upon Mb1392c perturbation

    • Perform phosphoproteomic analysis to identify potential signaling roles

  • Mathematical Modeling:

    • Develop kinetic models incorporating Mb1392c activity

    • Perform flux balance analysis including Mb1392c-related reactions

    • Create agent-based models of infection incorporating Mb1392c function

  • Visualization and Data Integration:

    • Use Cytoscape or similar tools for network visualization

    • Develop R or Python workflows for multi-omics data integration

    • Create interactive dashboards for collaborative data exploration

This integrated approach places Mb1392c research in the context of whole-organism biology, revealing system-level functions and interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.