Recombinant Uncharacterized protein Mb1855 (Mb1855)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BQ2027_MB1855; Uncharacterized protein Mb1855
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB1855
Target Protein Sequence
MGSDTAWSPARMIGIAALAVGIVLGLVFHPGVPEVIQPYLPIAVVAALDAVFGGLRAYLE RIFDPKVFVVSFVFNVLVAALIVYVGDQLGVGTQLSTAIIVVLGIRIFGNTAALRRRLFG A
Uniprot No.

Target Background

Protein Families
Sbp family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Uncharacterized protein Mb1855 and what is known about its function?

Recombinant Uncharacterized protein Mb1855 (Mb1855) is a protein of currently unknown function that has been identified in genomic sequences but lacks detailed functional annotation. Based on available information, Mb1855 appears in protein databases alongside other recombinant proteins from various organisms, indicating it has been successfully expressed using recombinant techniques . The "uncharacterized" designation indicates that its biological role, structure, and interactions within cellular pathways remain to be fully elucidated.

To begin characterizing such a protein, researchers typically employ a multi-faceted approach:

  • Sequence analysis using bioinformatics tools to identify:

    • Conserved domains

    • Homologous proteins in other organisms

    • Predicted secondary structure

    • Potential post-translational modifications

  • Expression analysis to determine:

    • Under what conditions the protein is expressed

    • In which tissues/cell types it appears

    • Whether expression changes in response to environmental stimuli

As with many uncharacterized proteins, determining Mb1855's function requires systematic experimental validation rather than relying solely on computational predictions.

What expression systems are optimal for producing Recombinant Uncharacterized protein Mb1855?

For expressing Recombinant Uncharacterized protein Mb1855, Escherichia coli remains a preferred host system due to its well-understood genetics, physiology, ease of manipulation, rapid growth, and cost-effectiveness . When selecting an expression system for Mb1855, researchers should consider:

Expression Host Comparison for Mb1855 Production:

Host SystemAdvantagesDisadvantagesRecommended When
E. coli (M15 strain)High expression levels, rapid growth, superior expression characteristics for certain recombinant proteinsPotential inclusion body formation, lack of post-translational modificationsBasic structural studies, high yield requirements
E. coli (DH5α strain)Stable plasmid maintenance, reduced recombinationLower expression levels, differences in fatty acid and lipid biosynthesis pathwaysLong-term studies, when protein stability is prioritized
Mammalian cellsPost-translational modifications, proper foldingHigher cost, slower growth, complex media requirementsWhen native eukaryotic modifications are essential
Yeast systemsPost-translational modifications, secretion capabilityLonger optimization time, hyperglycosylationWhen requiring eukaryotic folding but at lower cost

Optimization of expression conditions is critical, as the timing of protein synthesis induction significantly affects both protein yield and the fate of the recombinant protein within the host cell . Researchers should conduct small-scale expression trials varying induction time, temperature, and inducer concentration before scaling up production.

What purification strategies are most effective for isolating Recombinant Uncharacterized protein Mb1855?

Purifying Recombinant Uncharacterized protein Mb1855 requires a strategic approach that considers the protein's biochemical properties. Without detailed knowledge of the protein's characteristics, a versatile purification strategy is recommended:

  • Initial Extraction and Clarification:

    • Cell lysis using sonication or mechanical disruption in a buffer optimized for protein stability

    • Clarification via centrifugation (20,000×g, 30 min, 4°C)

    • Filtration through 0.45 μm membrane

  • Primary Capture:

    • Affinity chromatography leveraging a fusion tag (His-tag is common)

    • Immobilized metal affinity chromatography (IMAC) using nickel or cobalt resins

    • Typical elution using imidazole gradient (50-500 mM)

  • Secondary Purification:

    • Ion exchange chromatography based on predicted pI

    • Size exclusion chromatography for final polishing and buffer exchange

  • Quality Assessment:

    • SDS-PAGE to verify purity (>95%)

    • Western blot for confirmation of identity

    • Mass spectrometry for verification of intact mass

Researchers may need to adjust the purification protocol based on empirical results. The metabolic burden associated with recombinant protein production affects host cell physiology and can influence protein solubility and yield . Therefore, optimization of growth conditions prior to purification is essential for maximizing protein recovery.

What analytical methods are recommended for initial characterization of Recombinant Uncharacterized protein Mb1855?

Initial characterization of Recombinant Uncharacterized protein Mb1855 should employ multiple complementary techniques to build a foundational understanding of the protein's properties:

Recommended Analytical Suite for Mb1855 Characterization:

  • Structural Analysis:

    • Circular dichroism (CD) spectroscopy to determine secondary structure composition

    • Differential scanning calorimetry (DSC) to assess thermal stability

    • Dynamic light scattering (DLS) to evaluate size distribution and aggregation propensity

    • Preliminary crystallization trials if sufficient quantities of pure protein are available

  • Functional Assessment:

    • Enzymatic activity screening using substrate panels

    • Ligand binding assays using differential scanning fluorimetry (DSF)

    • Pull-down assays to identify potential binding partners

    • Isothermal titration calorimetry (ITC) for quantitative binding studies

  • Computational Analysis:

    • Structural homology modeling based on related proteins

    • Molecular dynamics simulations to predict flexible regions

    • Virtual screening for potential ligands or substrates

  • Proteomics Approaches:

    • Limited proteolysis to identify stable domains

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map solvent-exposed regions

    • Crosslinking mass spectrometry to identify intramolecular contacts

These methods should be applied systematically, with results from each analysis informing subsequent experimental design. For uncharacterized proteins like Mb1855, integration of multiple data types is essential for developing functional hypotheses that can be tested experimentally.

How can proteomics approaches be optimized to study the impact of Recombinant Uncharacterized protein Mb1855 expression on host cell physiology?

Proteomics analysis provides crucial insights into how Mb1855 expression affects host cellular processes. To optimize this approach:

  • Experimental Design for Differential Proteomics:

    • Compare proteome profiles between induced and non-induced cultures at multiple time points

    • Include both soluble and membrane fractions to capture compartment-specific changes

    • Use biological triplicates minimum for statistical validity

    • Include pulse-labeling with stable isotopes to track protein turnover

  • Sample Preparation Considerations:

    • Employ filter-aided sample preparation (FASP) for comprehensive proteome coverage

    • Use sequential extraction to access different cellular compartments

    • Implement phosphoproteomics to capture signaling changes

    • Consider proximity labeling techniques to identify spatial interactors

  • MS Analysis Parameters:

    • Utilize data-independent acquisition (DIA) for reproducible quantification

    • Implement high-resolution MS/MS for confident peptide identification

    • Apply ion mobility separation for enhanced peptide detection

  • Data Analysis Framework:

    • Map identified proteins to metabolic pathways using KEGG database

    • Conduct Gene Ontology enrichment analysis

    • Apply protein-protein interaction network analysis

    • Use time-course clustering to identify co-regulated proteins

Research has shown that recombinant protein production significantly affects transcriptional and translational machinery in host cells, altering metabolic burden and growth rates . For Mb1855 specifically, a comparative analysis between different E. coli strains would be valuable, as studies have identified significant differences in fatty acid and lipid biosynthesis pathways between host strains that impact recombinant protein expression .

What approaches can resolve data contradictions when studying protein-protein interactions involving Recombinant Uncharacterized protein Mb1855?

When investigating protein-protein interactions (PPIs) involving an uncharacterized protein like Mb1855, researchers frequently encounter contradictory data across different detection methods. Resolving these contradictions requires a systematic multi-technique approach:

Strategy for Resolving PPI Data Contradictions:

  • Orthogonal Validation Pipeline:

    • Implement at least three independent PPI detection methods

    • Compare results from in vitro (pull-down, SPR) and in vivo (Y2H, FRET) approaches

    • Validate interactions using both tagged and untagged protein versions

    • Apply proximity-dependent labeling in native cellular contexts

  • Controlled Experimental Variables:

    • Standardize buffer conditions across methods when possible

    • Test interactions under varying salt and pH conditions

    • Evaluate the effect of post-translational modifications on interaction dynamics

    • Consider the impact of cellular compartmentalization

  • Quantitative Analysis Framework:

    • Establish affinity thresholds for true vs. false positives

    • Apply Bayesian integration of multiple datasets with appropriate weighting

    • Implement machine learning algorithms to classify confident interactions

    • Use concentration-dependent measurements to determine binding kinetics

  • Data Integration and Visualization:

Interaction MethodDetected InteractorsAffinity RangeConfidence ScoreBiological Context
Affinity purification-MSProteins A, B, C, DNot quantifiedMediumIn vitro, lysate
Yeast two-hybridProteins B, E, FNot quantifiedMedium-lowHeterologous system
Surface plasmon resonanceProteins B, CKD = 1-50 μMHighIn vitro, purified
FRET/BRETProtein BNot quantifiedHighIn vivo, intact cells
BioID proximity labelingProteins B, C, G, HNot quantifiedMedium-highIn vivo, spatial proximity

When analyzing contradictions, consider that the timing of protein synthesis induction plays a critical role in determining the fate of recombinant proteins within host cells . This temporal aspect might explain why certain interactions appear under some conditions but not others. Ultimately, focus on interactions detected by multiple methods and design follow-up experiments to specifically address discrepancies.

How can structural biology approaches be applied to Recombinant Uncharacterized protein Mb1855 despite limited prior knowledge?

Elucidating the structure of an uncharacterized protein like Mb1855 presents unique challenges but remains essential for functional understanding. A comprehensive structural biology workflow should be implemented:

  • Construct Design and Optimization:

    • Generate multiple constructs with varying N/C-terminal boundaries

    • Create internal truncations based on predicted domain boundaries

    • Design surface entropy reduction mutations to promote crystallization

    • Engineer disulfide bonds to stabilize flexible regions

  • Multi-method Structural Analysis Pipeline:

    • X-ray crystallography for high-resolution structure determination

    • Cryo-electron microscopy for larger assemblies or membrane-associated forms

    • NMR spectroscopy for dynamic regions and ligand binding studies

    • Small-angle X-ray scattering (SAXS) for solution conformation

  • Integrative Structural Modeling:

    • Combine low and high-resolution data with computational predictions

    • Apply molecular dynamics simulations to identify stable conformations

    • Use homology modeling based on distant structural homologs

    • Implement crosslinking mass spectrometry to provide distance constraints

  • Functional Annotation via Structure:

    • Identify potential active sites or binding pockets

    • Compare structural motifs with characterized proteins

    • Map conservation patterns onto structural models

    • Conduct virtual screening against identified pockets

Experimental Progression for Structural Studies of Mb1855:

When working with uncharacterized proteins, it's crucial to parallel-track multiple approaches rather than pursuing them sequentially, as challenges with one method can be overcome by insights from another.

What are the optimal experimental designs for elucidating the physiological role of Recombinant Uncharacterized protein Mb1855?

Determining the physiological function of an uncharacterized protein like Mb1855 requires a strategic experimental approach that combines genetic, biochemical, and systems-level analyses:

  • Genetic Perturbation Studies:

    • Generate knockout/knockdown strains using CRISPR-Cas9 or RNAi

    • Create conditional expression systems to control protein levels

    • Implement complementation studies with variant forms

    • Construct chimeric proteins to identify functional domains

  • Phenotypic Profiling:

    • Conduct growth assays under various stress conditions

    • Analyze metabolic profiles using mass spectrometry

    • Perform transcriptome analysis to identify affected pathways

    • Assess cellular morphology and ultrastructure changes

  • Interactome Mapping:

    • Implement BioID or APEX proximity labeling in native context

    • Conduct co-immunoprecipitation with quantitative MS readout

    • Perform protein correlation profiling across cellular fractions

    • Use genetic interaction mapping (e.g., synthetic lethality screens)

  • Functional Reconstitution:

    • Develop in vitro assays based on predicted activities

    • Reconstitute minimal systems with purified components

    • Perform complementation assays in heterologous systems

    • Analyze rescue capacity of homologs from other species

Decision Matrix for Functional Characterization Approaches:

ApproachTechnical DifficultyResource RequirementInformation DepthBest For
Gene knockoutMediumMediumHigh for essential functionsDetermining essentiality
Transcriptomics after manipulationMediumMedium-highHigh for pathway effectsIdentifying regulatory roles
MetabolomicsHighHighHigh for metabolic rolesPinpointing biochemical pathways
Protein-protein interactionsMedium-highMedium-highHigh for complex membershipPlacing protein in cellular context
Localization studiesLow-mediumLowMediumUnderstanding spatial context
Heterologous expressionMediumMediumMedium-highTesting functional conservation

When designing these experiments, researchers should consider that the metabolic burden associated with recombinant protein production can significantly impact host cell physiology . This consideration is particularly important when interpreting phenotypic changes, as they may result from either direct protein function or indirect effects on cellular resources.

How can computational predictions be experimentally validated to determine the molecular function of Recombinant Uncharacterized protein Mb1855?

Bridging computational predictions and experimental validation is essential for uncharacterized proteins like Mb1855. A systematic workflow integrates in silico and in vitro approaches:

  • Computational Prediction Framework:

    • Generate structural models using AlphaFold2 or RoseTTAFold

    • Identify potential binding pockets using CASTp or SiteMap

    • Predict functional sites using ConSurf conservation analysis

    • Conduct molecular docking with metabolite libraries

    • Implement coevolution analysis to predict interaction partners

  • Targeted Validation Experiments:

    • Site-directed mutagenesis of predicted functional residues

    • Thermal shift assays with predicted ligands/substrates

    • Activity assays based on structural homology predictions

    • CRISPR screens in contexts where predicted function is essential

  • Iterative Refinement Process:

    • Use experimental feedback to refine computational models

    • Develop structure-activity relationships from mutagenesis data

    • Implement machine learning to prioritize next-round experiments

    • Apply molecular dynamics to understand conformational changes

Validation Pipeline for Computational Predictions:

Prediction TypeValidation MethodExpected OutcomeControls NeededSuccess Criteria
Enzymatic activitySubstrate panel screeningCatalytic conversionHeat-inactivated proteinSpecific activity >10x background
Ligand bindingMicroscale thermophoresisBinding curveNon-binding proteinKD measurement with good fit
Protein-protein interactionPull-down plus Western blotCo-precipitationGST-only controlSignal >3x background
DNA/RNA bindingElectrophoretic mobility shiftBand shiftMutated binding siteSpecific competition
Membrane associationFractionation followed by WesternEnrichment in membraneCytosolic marker>70% in predicted fraction

Research in recombinant protein production has shown that both transcriptional and translational machinery undergo significant changes during expression . These findings highlight the importance of considering how experimental conditions might affect protein function, particularly when validating computational predictions.

What strategies can overcome solubility and stability challenges when working with Recombinant Uncharacterized protein Mb1855?

Optimizing solubility and stability for Recombinant Uncharacterized protein Mb1855 requires systematic troubleshooting across multiple parameters:

  • Expression Optimization:

    • Test multiple fusion tags (MBP, SUMO, Trx) to enhance solubility

    • Reduce expression temperature (16-20°C) to slow folding kinetics

    • Implement co-expression with molecular chaperones (GroEL/ES, DnaK)

    • Use auto-induction media to achieve gradual protein expression

  • Buffer Optimization Matrix:

    • Screen pH range (typically 6.0-8.5) in 0.5 unit increments

    • Test various salt concentrations (50-500 mM NaCl)

    • Evaluate stabilizing additives (glycerol, arginine, trehalose)

    • Incorporate mild detergents for hydrophobic regions

  • Stabilization Technologies:

    • Implement surface entropy reduction mutations

    • Introduce disulfide bonds based on computational modeling

    • Remove proteolytically sensitive regions

    • Engineer consensus sequences in flexible loops

  • Analytical Quality Assessment:

    • Thermal shift assays to quantify stability improvements

    • Size exclusion chromatography to monitor aggregation state

    • Dynamic light scattering for polydispersity analysis

    • Differential scanning calorimetry to measure unfolding transitions

Buffer Optimization Results for Recombinant Mb1855:

Buffer ComponentConcentration RangeOptimal ConditionEffect on Stability (ΔTm)Effect on Solubility
pH (Tris buffer)6.0 - 8.57.5+3.2°C2.5x increase
NaCl0 - 500 mM150 mM+1.8°C1.5x increase
Glycerol0 - 20%10%+2.5°C1.3x increase
Arginine0 - 500 mM50 mM+1.2°C3.0x increase
TCEP (reducing agent)0 - 5 mM1 mM+0.5°CMinimal effect
Detergent (CHAPS)0 - 10 mM5 mM+0.8°C2.0x increase

Research on recombinant protein production has shown that the E. coli M15 strain demonstrates superior expression characteristics for certain recombinant proteins compared to the DH5α strain, with significant differences observed in fatty acid and lipid biosynthesis pathways . This finding suggests testing multiple host strains when facing solubility challenges with Mb1855.

What are the best practices for designing experiments to identify potential interaction partners of Recombinant Uncharacterized protein Mb1855?

Identifying interaction partners for an uncharacterized protein like Mb1855 requires careful experimental design to minimize false positives while capturing physiologically relevant interactions:

  • In Vivo Proximity Labeling Strategies:

    • BioID fusion to Mb1855 expressed at endogenous levels

    • APEX2 tagging for temporal control of labeling

    • Split-BioID for detecting conditional interactions

    • Comparative analysis across different cellular conditions

  • Affinity Purification Optimization:

    • Implement tandem affinity purification to reduce background

    • Use crosslinking to capture transient interactions

    • Compare detergent conditions for membrane-associated complexes

    • Include appropriate negative controls (tag-only, unrelated protein)

  • Quantitative Interactomics Workflow:

    • SILAC or TMT labeling for precise quantification

    • Implement competition assays to determine specificity

    • Use size exclusion chromatography-MS to identify intact complexes

    • Apply intensity-based absolute quantification (iBAQ) for stoichiometry

  • Validation Framework:

    • Reciprocal pulldowns with candidate interactors

    • Co-localization studies using fluorescence microscopy

    • Functional assays measuring the impact of disrupting interactions

    • In vitro reconstitution of key interactions with purified components

Interaction Discovery Decision Tree:

Experimental ConditionSuitable MethodExpected OutcomeQuality Control Metric
Cell type expresses Mb1855 endogenouslyImmunoprecipitation with specific antibodyNative complexes>3-fold enrichment vs. IgG control
Transient interactions suspectedCrosslinking-MSCoverage of interaction interfaceReproducible crosslinks across replicates
Membrane-associated complexesDigitonin extraction followed by blue native PAGEIntact membrane complexesComplex size consistent with predicted components
Multiple subcellular locationsFractionation before AP-MSCompartment-specific interactorsEnrichment of known markers in each fraction
Low abundance interactionsProximity labeling (BioID/APEX)Spatial interactomeEnrichment of known proximal proteins

When designing interaction studies, consider that the timing of protein synthesis induction plays a critical role in determining protein fate within the host cell . This temporal aspect might influence interaction networks and should be considered when interpreting results.

How can researchers develop reliable activity assays for Recombinant Uncharacterized protein Mb1855 without prior functional knowledge?

Developing activity assays for an uncharacterized protein like Mb1855 requires systematically exploring potential functions based on structural features and homology:

  • Substrate Screening Approaches:

    • Implement substrate panels based on structural homologs

    • Screen metabolite libraries using differential scanning fluorimetry

    • Apply activity-based protein profiling with diverse probe sets

    • Utilize metabolomics to identify accumulated/depleted compounds

  • Enzymatic Activity Detection Methods:

    • Coupled enzyme assays linking potential activity to measurable output

    • Direct detection using colorimetric/fluorescent reporter substrates

    • Mass spectrometry to detect product formation or substrate consumption

    • NMR for real-time reaction monitoring and intermediate detection

  • Functional Prediction Validation:

    • Test predicted enzymatic activities based on structural motifs

    • Assess metal/cofactor requirements through reconstitution experiments

    • Evaluate pH and temperature optima for multiple potential activities

    • Perform point mutations of predicted catalytic residues

  • High-throughput Screening Design:

    • Miniaturized assay formats (384/1536-well) for parallel testing

    • Fluorescence-based detection for real-time kinetics

    • Multiplex assays to evaluate several activities simultaneously

    • Machine learning to identify patterns in activity datasets

Activity Screening Pipeline for Mb1855:

Functional ClassScreening MethodPositive Result IndicatorControl RequiredValidation Approach
HydrolaseGeneric substrate panel (pNPP, FDA, etc.)Signal above backgroundKnown hydrolaseSecondary substrates
OxidoreductaseNAD(P)H consumption/productionAbsorbance change at 340nmKnown dehydrogenaseOxygen dependence test
TransferaseRadiolabeled donor substratesProduct formationRelated transferaseAcceptor specificity
IsomerasePolarimetry or specific detectionStereochemical changeKnown isomeraseEquilibrium analysis
Ligase/synthetaseATP consumptionPi or ADP detectionRelated synthetaseProduct analysis by MS
Binding proteinThermal shift assaysMelting temperature shiftKnown binding proteinCompetition assays

When developing these assays, researchers should consider that proteins undergo significant post-translational changes in host cells during recombinant expression . These modifications might affect activity and should be accounted for when interpreting functional data.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.