Recombinant Uncharacterized protein Mb2011c (Mb2011c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mbcT; BQ2027_MB2011C; NAD(+ phosphorylase MbcT; Mycobacterial cidal toxin MbcT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB2011C
Target Protein Sequence
MSDALDEGLVQRIDARGTIEWSETCYRYTGAHRDALSGEGARRFGGRWNPPLLFPAIYLA DSAQACMVEVERAAQAASTTAEKMLEAAYRLHTIDVTDLAVLDLTTPQAREAVGLENDDI YGDDWSGCQAVGHAAWFLHMQGVLVPAAGGVGLVVTAYEQRTRPGQLQLRQSVDLTPALY QELRAT
Uniprot No.

Target Background

Function
A toxic component of a type II toxin-antitoxin (TA) system. It degrades NAD+ via phosphorolysis and is neutralized by its cognate antitoxin, MbcA.

Q&A

What is Mb2011c and what organism does it originate from?

Mb2011c is an uncharacterized protein from Mycobacterium bovis, a pathogenic bacterial species closely related to Mycobacterium tuberculosis. The "Mb" prefix in the protein identifier specifically refers to Mycobacterium bovis, while the numerical designation "2011c" indicates its position in the genome, with the "c" suffix typically denoting its location on the complementary strand . As a "conserved hypothetical" protein, Mb2011c has been identified through genomic sequencing, but its precise biochemical function remains undetermined despite conservation across mycobacterial species, suggesting functional importance.

What is known about the orthologous relationships of Mb2011c?

According to comparative genomic analysis, Mb2011c has been identified as orthologous to the Rv1989c protein from Mycobacterium tuberculosis H37Rv strain . The ortholog table categorizes these proteins as "identical, conserved hypotheticals," indicating a high degree of sequence conservation between these two mycobacterial species. This conservation suggests that the protein likely serves an important biological function that has been maintained through evolutionary processes. Researchers can leverage this orthologous relationship to potentially transfer functional annotations or experimental findings between the two bacterial species.

Why are proteins like Mb2011c classified as "conserved hypotheticals"?

Proteins receive the "conserved hypothetical" classification when they meet two key criteria: (1) they have no experimentally determined function (hence "hypothetical"), and (2) they show sequence conservation across multiple species or strains (hence "conserved") . This conservation across evolutionary distance strongly suggests functional importance, as selective pressure typically preserves proteins that serve necessary biological roles. The "hypothetical" designation indicates that while bioinformatic analysis confirms its existence as a protein-coding gene, no experimental evidence has yet defined its biochemical activity, cellular role, or contribution to bacterial physiology.

What are the recommended approaches for cloning and expressing recombinant Mb2011c?

When working with an uncharacterized protein like Mb2011c, researchers should implement a systematic approach for recombinant expression:

First, obtain the gene sequence from genomic databases for Mycobacterium bovis. Design primers that incorporate appropriate restriction sites for cloning, similar to methodologies used in other mycobacterial protein studies . When designing an expression system, consider testing multiple vectors (pET, pGEX, pMAL) and host strains (E. coli BL21(DE3), Rosetta, Arctic Express) to optimize protein solubility and yield.

For mycobacterial proteins specifically, expression conditions often require optimization. Consider testing expression at lower temperatures (16-20°C), varying IPTG concentrations (0.1-1.0 mM), and including solubility-enhancing fusion tags (MBP, SUMO, thioredoxin). If initial E. coli expression attempts yield insoluble protein, consider mycobacterial expression systems like M. smegmatis, which may provide a more native environment for proper folding of Mb2011c.

What methods should be employed for structural characterization of Mb2011c?

For an uncharacterized protein like Mb2011c, a hierarchical approach to structural characterization is recommended:

Begin with secondary structure analysis using circular dichroism (CD) spectroscopy to determine α-helical and β-sheet content. This provides initial structural insights with relatively small amounts of protein. Follow with more detailed tertiary structure investigations using approaches such as X-ray crystallography, which requires obtaining protein crystals through systematic screening of crystallization conditions. For mycobacterial proteins, crystallization screens focusing on conditions successful for other mycobacterial proteins may increase chances of success.

If crystallization proves challenging, alternative methods include Nuclear Magnetic Resonance (NMR) spectroscopy (suitable for smaller proteins), cryo-electron microscopy (particularly valuable if Mb2011c forms larger complexes), or small-angle X-ray scattering (SAXS) for low-resolution structural information in solution.

Additionally, employ bioinformatic approaches like homology modeling based on structures of distant homologs, even with low sequence identity. These computational predictions can guide experimental design and provide preliminary structural insights when experimental data is limited.

What approaches should be used to identify potential binding partners of Mb2011c?

To identify interaction partners of Mb2011c, researchers should consider a multi-technique approach:

Affinity purification coupled with mass spectrometry (AP-MS) serves as an effective initial screening method. Express tagged Mb2011c (His-tag or FLAG-tag) in mycobacterial cells, perform pull-down experiments under varying conditions (different growth phases, stress conditions), and identify co-purified proteins using mass spectrometry. For validation of identified interactions, employ orthogonal methods such as bacterial two-hybrid systems, surface plasmon resonance (SPR), or isothermal titration calorimetry (ITC) to confirm direct binding and determine binding kinetics.

Additionally, investigate genetic interactions through synthetic genetic arrays or epistasis analysis. Coordinated expression patterns with other genes may also provide clues to protein partnerships, so analyze transcriptomic data sets from mycobacterial species under various conditions to identify genes with expression profiles similar to Mb2011c/Rv1989c.

How should researchers design knockout experiments to determine the functional role of Mb2011c?

When designing knockout studies for Mb2011c, implement a comprehensive approach:

Begin by creating a clean deletion mutant using homologous recombination techniques adapted for mycobacteria, ensuring removal of the entire coding sequence without disrupting adjacent genes. Since mycobacteria are often difficult to transform, consider specialized protocols that enhance transformation efficiency. For validation, confirm the deletion using multiple methods (PCR, sequencing, and RT-qPCR) to ensure complete removal of the gene and absence of expression.

Phenotypic characterization should proceed systematically across multiple growth conditions, including standard laboratory media, nutrient-limited conditions, various carbon sources, different pH levels, oxidative stress, nitrosative stress, and hypoxia. Additionally, assess intracellular survival in macrophage infection models and animal infection models if appropriate facilities are available.

Remember to include complementation controls by reintroducing the wild-type gene on a plasmid or at a neutral chromosomal site to confirm that observed phenotypes result specifically from the absence of Mb2011c rather than polar effects or secondary mutations.

What approaches can resolve contradictory data when characterizing Mb2011c?

When confronting contradictory results in the study of uncharacterized proteins like Mb2011c, employ these methodological approaches:

First, systematically document all experimental conditions and variables that might influence outcomes, including protein preparation methods, buffer compositions, expression systems, and assay conditions. Verify protein identity and integrity using mass spectrometry and SDS-PAGE to ensure that degradation or post-translational modifications aren't causing variability.

For contradictory phenotypic results in genetic studies, verify gene deletion using multiple methods (PCR, sequencing, RT-qPCR) and rule out polar effects on adjacent genes. Generate independent mutant strains to confirm reproducibility of phenotypes. For complementation studies, ensure expression levels are similar to native conditions, as both under- and over-expression can complicate interpretation.

When functional assays yield conflicting results, consider biological context—Mb2011c might have different activities under different physiological conditions. Test activity across a range of pH values, temperatures, salt concentrations, and in the presence of various cofactors or metals to identify condition-dependent functionality.

How can computational approaches complement experimental characterization of Mb2011c?

Computational methods offer powerful complementary approaches to experimental work on uncharacterized proteins like Mb2011c:

For functional prediction, employ multiple complementary approaches including sequence-based methods (search for conserved domains using databases like Pfam, SMART, or CDD), structure-based annotation (identify potential binding pockets or catalytic sites based on structural similarity to characterized proteins), and genomic context methods (analyze gene neighborhood, fusion events, and co-occurrence patterns across species).

For structural predictions, beyond traditional homology modeling, leverage AI-based structure prediction tools which have demonstrated impressive accuracy even for proteins with few homologs. These predicted structures can guide the design of site-directed mutagenesis experiments targeting potential functional residues.

Importantly, integrate results from multiple computational approaches, prioritizing predictions supported by several methods. Use these predictions to design targeted experimental validation rather than testing possibilities randomly, thereby accelerating the characterization process.

How should researchers integrate multi-omics data to understand Mb2011c function?

For comprehensive characterization of Mb2011c, implement an integrative multi-omics strategy:

Begin by generating or analyzing transcriptomic data to identify conditions where Mb2011c/Rv1989c expression is significantly altered, providing clues to its functional context. Compare transcriptomes of wild-type and Mb2011c deletion strains under multiple conditions to identify genes with expression patterns dependent on Mb2011c presence.

Complement transcriptomics with proteomics analysis, comparing protein abundance profiles between wild-type and mutant strains. Pay particular attention to changes in protein complexes that might include Mb2011c as a component. Additionally, employ phosphoproteomics and other post-translational modification analyses to determine if Mb2011c undergoes regulatory modifications or affects modification patterns of other proteins.

For metabolomic integration, conduct untargeted metabolite profiling comparing wild-type and knockout strains under various conditions. Metabolic changes may provide direct evidence of biochemical pathways affected by Mb2011c activity. Integrate these data types using pathway analysis tools and statistical methods designed for multi-omics data integration, such as multi-block principal component analysis or similarity network fusion.

What specialized techniques can determine if Mb2011c has enzymatic activity?

To investigate potential enzymatic functions of Mb2011c, implement a systematic screening approach:

Begin with broad-spectrum activity screening using substrate panels for major enzyme classes (hydrolases, transferases, oxidoreductases, isomerases). For each class, test multiple substrate types with varying structural features. If initial screens suggest activity, perform detailed kinetic analysis to determine catalytic parameters (Km, kcat, substrate specificity).

For unbiased activity detection, implement activity-based protein profiling (ABPP) using probe libraries that react with specific enzyme classes. Additionally, consider metabolite profiling of culture supernatants or cell extracts from wild-type versus knockout strains to identify accumulating substrates or depleted products, indicating potential enzymatic function.

If structural analysis or computational prediction identifies potential active site residues, perform site-directed mutagenesis of these residues followed by activity testing to confirm their importance. For proteins with no detectable canonical enzymatic activity, investigate non-enzymatic functions such as scaffold proteins, allosteric regulators, or stress response factors through protein-protein interaction studies and phenotypic analyses.

How can researchers determine if Mb2011c plays a role in Mycobacterium pathogenesis?

To investigate Mb2011c's potential role in pathogenesis, implement a multi-level approach:

Begin with in vitro infection models using macrophage cell lines (RAW264.7, THP-1) and primary macrophages. Compare intracellular survival and replication of wild-type and Mb2011c knockout strains. Analyze immune response parameters including cytokine production, phagosomal maturation, and macrophage cell death pathways to determine if Mb2011c affects host-pathogen interactions.

For ex vivo models, employ precision-cut lung slices or granuloma models that better represent the complex tissue environment encountered during infection. If preliminary studies suggest a role in pathogenesis, proceed to appropriate animal models, comparing bacterial burden, histopathology, and survival between animals infected with wild-type versus mutant strains.

At the molecular level, investigate whether Mb2011c interacts with host proteins through techniques like bacterial two-hybrid screens against human protein libraries or co-immunoprecipitation from infected cell lysates. Additionally, determine if Mb2011c expression is altered during different stages of infection using transcriptomics of bacteria isolated from host tissues or macrophages.

What novel technologies might accelerate characterization of proteins like Mb2011c?

Emerging technologies show particular promise for accelerating the characterization of uncharacterized proteins like Mb2011c:

In structural biology, advancements in cryo-electron microscopy now enable structure determination of increasingly smaller proteins at near-atomic resolution. Additionally, integrative structural biology approaches combining multiple experimental data types with computational modeling prove particularly valuable for challenging targets.

For functional studies, CRISPR interference (CRISPRi) systems adapted for mycobacteria allow titratable gene repression, enabling the study of essential genes while avoiding the complications of complete knockout. CRISPRi also facilitates large-scale functional genomic screens that could reveal the roles of many uncharacterized proteins simultaneously.

Metabolomics technologies continue to improve in sensitivity and coverage, enabling more comprehensive profiling of metabolic changes resulting from gene deletion. Advanced mass spectrometry approaches provide enhanced separation of isomeric compounds, potentially revealing subtle metabolic shifts that could indicate Mb2011c function.

Single-cell technologies adapted for bacterial cells may reveal phenotypic heterogeneity in bacterial populations that could be crucial for understanding Mb2011c's function in subpopulations under stress conditions or during different infection stages.

How might understanding Mb2011c function contribute to tuberculosis research?

Elucidating the function of conserved hypothetical proteins like Mb2011c has broader implications for tuberculosis research:

From a basic science perspective, characterizing Mb2011c addresses fundamental gaps in our understanding of mycobacterial biology. Conserved hypothetical proteins represent a significant proportion of mycobacterial genomes, and each functional characterization improves our comprehension of these important pathogens. The high conservation between Mb2011c and Rv1989c suggests an important biological role that has been maintained through evolution .

If Mb2011c proves to be involved in pathogenesis, virulence, or antibiotic resistance, it could represent a novel drug target. Proteins unique to mycobacteria and essential for their survival are particularly valuable targets for selective inhibition. Even if not directly targetable, understanding Mb2011c's function may reveal previously unknown biological pathways or mechanisms that could be exploited therapeutically.

Furthermore, functionally annotating conserved hypothetical proteins improves genome-scale metabolic models of mycobacteria, enhancing their utility for predicting growth phenotypes, drug susceptibilities, and metabolic capabilities. These improved models accelerate both basic research and applied studies seeking new intervention strategies against tuberculosis and related mycobacterial diseases.

What experimental protocols should be standardized for studying uncharacterized mycobacterial proteins?

To accelerate characterization of uncharacterized proteins like Mb2011c, researchers should establish standardized protocols in several key areas:

For expression and purification, develop optimized protocols for mycobacterial protein expression in E. coli and mycobacterial host systems, with standardized fusion tags, expression conditions, and purification strategies. These protocols should include quality control metrics for protein purity, folding, and stability assessment before functional studies begin.

In genetic manipulation, standardize gene knockout methodologies including primer design rules, vector systems, confirmation strategies, and complementation approaches. Implement consistent phenotypic testing panels that assess growth across multiple media types, stress conditions, and carbon sources to facilitate cross-comparison between different uncharacterized proteins.

For structural characterization, develop automated pipelines that progress from computational prediction through experimental validation, incorporating standardized expression constructs designed for crystallization, NMR, or cryo-EM studies. Finally, establish centralized databases for sharing preliminary characterization data about uncharacterized proteins, even before complete functional assignment, to prevent duplication of efforts and accelerate discovery.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.