Recombinant Uncharacterized protein Mb2102c (Mb2102c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
BQ2027_MB2102C; Uncharacterized protein Mb2102c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
46-323
Protein Length
Full Length of Mature Protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB2102C
Target Protein Sequence
WNGAGGDGLRQRTRADFSTVSGIADQLRRAATIARNGAGTIDAAQRRVMYAVEDAQDAGF NVGEDLSVTDTKTTQPAAVQAARLAQAQALAGDIRLRVGQLVAAENEVSGQLAATTGDVG NVRFAGAPVVAHSAVQLVDFFKQDGPTPPPPGAPHPSGGADGPYSDPITSMMLPPAGTEA PVSDATKRWVDNMVNELAARPPDDPIAVEARRLAFQALHRPCNSAEWTAAVAGFAGSSAG VVGTALAIPAGPADWALLGAALLGVGGSGAAVVNCATK
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the most reliable methods for initial expression analysis of recombinant Mb2102c?

For rapid screening of expression conditions for Mb2102c, a dot-blot experiment provides a significantly faster alternative to traditional SDS-PAGE and western blotting. This method can confirm protein expression in under one hour, allowing for quick optimization of growth conditions . The protocol involves:

  • Lysing cells directly from culture

  • Spotting lysate on nitrocellulose membrane

  • Incubating with HRP-conjugated antibody against the protein's affinity tag

  • Visualizing via chemiluminescence

This approach is particularly valuable when testing multiple variables such as:

  • Different expression host cell lines

  • Varying incubation temperatures

  • Testing optimal inducer concentrations

  • Determining ideal harvest times

The method's simplicity makes it ideal for preliminary expression tests before committing to large-scale cultures or more resource-intensive purification steps .

What computational approaches should be prioritized for initial characterization of Mb2102c?

Initial computational characterization should follow a systematic pipeline that begins with basic physicochemical parameter prediction and advances to more complex analyses. The workflow should include:

  • Physicochemical property analysis using tools like Expasy's ProtParam for:

    • Molecular weight determination

    • Isoelectric point

    • Extinction coefficient

    • GRAVY (Grand Average of Hydropathicity) value to determine hydrophilic/hydrophobic nature

    • Instability index (values <40 indicate stable proteins)

  • Domain and motif identification using multiple databases to achieve consensus predictions

    • Conserved Domain Database

    • Pfam

    • SMART

    • PROSITE

  • Subcellular localization prediction using tools like PSORT, CELLO, and SignalP

Following this systematic approach has demonstrated approximately 83.6% accuracy in correctly predicting protein functions, as validated through ROC analysis of known proteins .

How can I design the most informative experiments to characterize Mb2102c with minimal resource expenditure?

Optimal experimental design can significantly accelerate knowledge discovery while reducing resource usage. The OPEX (Optimal Experimental Design) method offers a strategic approach:

  • Use machine learning models to identify the most informative experiments

  • Prioritize experiments that maximize learning about the protein's function

  • Implement an iterative design process:

    • Begin with broad exploration of experimental conditions

    • Gradually narrow focus based on initial results

    • Fine-tune specific conditions in later stages

This approach has been demonstrated to produce more accurate predictive models with up to 44% less experimental data compared to conventional approaches . For Mb2102c characterization, this would involve:

  • Initial screening across diverse conditions (pH, temperature, ligands)

  • Identifying conditions that produce the most distinctive responses

  • Focusing subsequent experiments on these informative conditions

What expression systems are most appropriate for producing Mb2102c for structural studies?

The choice of expression system depends on the intended downstream applications, particularly for structural studies which require high-quality, properly folded protein. Based on approaches used for other uncharacterized proteins:

  • Mammalian cell expression systems:

    • Provide proper post-translational modifications

    • Yield properly folded proteins suitable for biochemical, biophysical, and structural studies

    • Enable production of up to milligram quantities of analytically pure protein

  • Bacterial expression systems:

    • Most appropriate for initial screening due to rapid growth

    • May require optimization of codon usage for mycobacterial proteins

    • Useful for producing protein domains rather than full-length proteins

For structural determination by methods like cryo-EM, mammalian expression systems have demonstrated success in producing high-quality recombinant proteins that exhibit clear thermal unfolding transitions and retain biological activity .

What integrated bioinformatic approach is most effective for predicting the function of Mb2102c?

An effective functional annotation pipeline for uncharacterized proteins involves multiple complementary methods:

  • Sequence-based analysis:

    • Homology searches using BLAST against various databases

    • Motif and pattern identification using tools like InterProScan

    • Transmembrane region prediction using TMHMM

    • Signal peptide prediction using SignalP

  • Structure-based analysis:

    • Template-based structure prediction using Swiss-Model

    • Ab initio modeling using Phyre2

    • Functional inference from structural similarities

  • Interaction network analysis:

    • Protein-protein interaction prediction using STRING

    • Genomic context analysis (gene neighborhood, fusion events)

    • Co-expression data integration

This integrated approach has successfully assigned functions to previously uncharacterized proteins with an average accuracy of 83.6%, as determined by ROC analysis .

Table 1: Accuracy metrics for different prediction categories in functional annotation of uncharacterized proteins

How can ChIP-exo technology be applied to determine if Mb2102c functions as a transcription factor?

If preliminary analysis suggests Mb2102c may function as a DNA-binding protein or transcription factor, ChIP-exo represents a powerful approach for validation:

  • Experimental setup:

    • Express tagged Mb2102c in appropriate host cells

    • Perform multiplexed chromatin immunoprecipitation combined with lambda exonuclease digestion (ChIP-exo)

    • Sequence the resulting DNA fragments to identify binding sites

  • Data analysis workflow:

    • Map sequence reads to reference genome

    • Identify enriched binding regions

    • Determine binding motifs through comparative analysis

    • Compare binding site locations with RNA polymerase binding sites to infer regulatory roles

This approach has successfully characterized 34 of 40 candidate transcription factors in E. coli, expanding the validated transcriptional regulatory network by approximately 12% . For Mb2102c, this method could definitively determine:

  • Whether it binds DNA

  • Its specific binding motif

  • Potential regulatory targets

  • Classification as a global, local, or single-target regulator

What approaches should be used to determine if Mb2102c forms multimeric complexes?

Determining the oligomeric state of Mb2102c requires a combination of in vitro and in vivo approaches:

  • In vitro methods:

    • Cross-linking of purified protein with glutaraldehyde followed by SDS-PAGE analysis

    • Size-exclusion chromatography to determine native molecular weight

    • Analytical ultracentrifugation for precise determination of oligomeric states

  • In vivo methods:

    • Co-immunoprecipitation of differently tagged versions of the protein

    • Mammalian two-hybrid or split-GFP assays

    • FRET analysis of tagged proteins

A comprehensive approach demonstrated for the BTB domain-containing protein SANBR showed that:

  • The purified recombinant BTB domain exhibited dimerization properties

  • Cross-linking with glutaraldehyde produced a species of approximately double the molecular weight on SDS-PAGE

  • In vivo dimerization was confirmed through co-expression of differently tagged versions and co-immunoprecipitation

Similar methodologies can be applied to determine if Mb2102c forms functional multimers and identify the domains responsible for any oligomerization.

How can I identify potential protein interaction partners of Mb2102c?

Identifying interaction partners is critical for understanding protein function. A multi-tiered approach includes:

  • Computational predictions:

    • STRING database analysis to predict functional associations

    • Homology-based inference from related proteins with known interactions

  • Experimental validation:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Yeast two-hybrid screening against genomic libraries

    • Protein microarray analysis

  • Functional validation:

    • Co-immunoprecipitation of endogenous proteins

    • Proximity-dependent biotin identification (BioID)

    • Functional assays with potential partners

For BTB domain-containing proteins like SANBR, interactions with co-repressors were identified and validated using these approaches, revealing functional mechanisms . If Mb2102c contains domains associated with protein-protein interactions, similar strategies would elucidate its interaction network.

What genetic approaches can validate the predicted function of Mb2102c?

Genetic validation is essential to confirm computationally predicted functions of uncharacterized proteins:

  • Gene deletion/knockout:

    • Generate deletion mutants using CRISPR-Cas9 or homologous recombination

    • Analyze phenotypic changes under various conditions

    • Identify stress conditions where the protein becomes essential

  • Gene expression analysis:

    • RNA-seq comparison between wild-type and mutant strains

    • Calculation of differentially expressed genes using tools like DESeq2

    • Pathway enrichment analysis of affected genes

  • Complementation studies:

    • Express wild-type and mutated versions in knockout strains

    • Test for restoration of phenotypes

    • Identify critical residues through site-directed mutagenesis

This systematic approach has successfully validated the functions of several uncharacterized transcription factors in E. coli, revealing their roles in replication, transcription, nutrition metabolism, and stress responses .

How can cross-stress protection experiments reveal the functional role of Mb2102c?

Cross-stress protection experiments can provide functional insights for uncharacterized proteins, particularly those involved in stress response:

  • Experimental design:

    • Expose cells to combinations of biocides and antibiotics

    • Compare gene expression profiles between wild-type and Mb2102c mutants

    • Identify conditions where Mb2102c affects survival or gene expression

  • Data analysis:

    • Look for cross-stress protection (enhanced survival under secondary stress)

    • Identify cross-stress vulnerability (decreased survival under secondary stress)

    • Map Mb2102c within the cellular stress response network

Similar approaches have revealed 29 cases of cross-stress protection and 4 cases of cross-stress vulnerability in E. coli, highlighting the role of chaperones, stress response proteins, and transport pumps . Such experiments could position Mb2102c within stress response pathways.

What strategies can overcome low expression yields of Mb2102c?

Low expression yields of uncharacterized proteins like Mb2102c can be addressed through multiple optimization strategies:

  • Expression system selection:

    • Test multiple expression systems (bacterial, mammalian, insect cells)

    • Evaluate different promoters and induction conditions

    • Consider cell-free expression systems for toxic proteins

  • Protein engineering approaches:

    • Create fusion proteins with solubility-enhancing tags

    • Remove predicted disordered regions

    • Design codon-optimized synthetic genes

  • Expression condition optimization:

    • Systematic testing of temperature, inducer concentration, and media composition

    • Use of chemical chaperones or co-expression with molecular chaperones

    • Implement high-throughput screening using the dot-blot method for rapid condition assessment

For challenging membrane proteins, special consideration should be given to detergent selection during purification, as demonstrated for CFTR proteins where proper folding and activity were maintained through optimized purification protocols .

How can I distinguish between direct and indirect regulatory effects of Mb2102c if it functions as a transcription factor?

Distinguishing direct from indirect regulatory effects requires integration of multiple experimental approaches:

  • Genome-wide binding profile:

    • ChIP-exo to map all binding sites with high resolution

    • Motif analysis to identify consensus binding sequences

    • Comparison with RNA polymerase binding sites

  • Transcriptome analysis:

    • RNA-seq of wild-type vs. deletion mutants

    • Time-course analysis after induction/repression

    • Classification of early (likely direct) vs. late (potentially indirect) responses

  • In vitro validation:

    • Electrophoretic mobility shift assays with purified protein

    • DNase footprinting to confirm binding sites

    • Reporter assays to validate regulatory effects

This integrated approach can classify regulatory proteins into categories based on their target scope:

  • Global regulators (>100 target genes)

  • Local regulators (<100 target genes)

  • Single-target regulators

Such classification provides insight into the protein's role within the broader regulatory network .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.