Recombinant Uncharacterized protein Mb2118c (Mb2118c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
BQ2027_MB2118C; Uncharacterized protein Mb2118c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB2118C
Target Protein Sequence
MSGPQGSDPRQPWQPPGQGADHSSDPTVAAGYPWQQQPTQEATWQAPAYTPQYQQPADPA YPQQYPQPTPGYAQPEQFGAQPTQLGVPGQYGQYQQPGQYGQPGQYGQPGQYAPPGQYPG QYGPYGQSGQGSKRSVAVIGGVIAVMAVLFIGAVLILGFWAPGFFVTTKLDVIKAQAGVQ QVLTDETTGYGAKNVKDVKCNNGSDPTVKKGATFECTVSIDGTSKRVTVTFQDNKGTYEV GRPQ
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Recombinant Uncharacterized Protein Mb2118c?

Recombinant Uncharacterized Protein Mb2118c is a protein encoded by the Mb2118c gene in Mycobacterium bovis. As an uncharacterized protein, its precise function remains undetermined, though it likely plays a role in mycobacterial cellular processes. When studying such proteins, researchers typically begin by examining its amino acid sequence for conserved domains, structural motifs, and homology with characterized proteins from related species. The recombinant form refers to the protein produced in an exogenous host system rather than its native organism, facilitating various experimental applications including structural studies, functional assays, and antibody production .

What expression systems are most effective for producing Recombinant Mb2118c?

The optimal expression system for Recombinant Mb2118c depends on research objectives and downstream applications. For mycobacterial proteins, the following systems offer distinct advantages:

Expression SystemAdvantagesLimitationsRecommended Use Case
E. coliHigh yield, rapid growth, cost-effectiveMay lack proper PTMs, potential inclusion body formationInitial structural studies, antibody generation
M. smegmatisNative-like PTMs, proper foldingLower yield, slower growthFunctional studies requiring mycobacterial PTMs
Insect cellsComplex PTMs, good solubilityHigher cost, technical complexityStructural biology, interaction studies
Cell-free systemsRapid, avoids toxicity issuesLimited PTMs, higher costQuick screening, toxic protein expression

When expressing Mb2118c, researchers should consider codon optimization for the host organism, fusion tags for purification and solubility enhancement, and induction conditions that maximize yield while ensuring proper folding .

How can I verify the identity and purity of recombinant Mb2118c?

Verification should employ multiple analytical methods:

  • SDS-PAGE analysis: Confirms molecular weight and initial purity assessment

  • Western blotting: Verifies identity using anti-His tag antibodies (if His-tagged) or protein-specific antibodies

  • Mass spectrometry: Provides precise molecular weight and can confirm amino acid sequence through peptide mapping

  • Size exclusion chromatography: Assesses aggregation state and homogeneity

  • Dynamic light scattering: Evaluates size distribution and potential aggregation

For highest confidence, combine at least three different methods. Purity should exceed 90% for most research applications, with endotoxin levels below 1 EU/μg for cell-based assays .

How should I design experiments to determine Mb2118c's function?

Determining the function of an uncharacterized protein like Mb2118c requires a systematic approach:

  • Bioinformatic analysis: Begin with sequence homology searches, protein family identification, and structural predictions to generate initial hypotheses about function.

  • Localization studies: Determine subcellular localization using fluorescently tagged versions or subcellular fractionation followed by Western blotting.

  • Interaction studies:

    • Pull-down assays with potential binding partners

    • Yeast two-hybrid screening

    • Proximity labeling approaches (BioID, APEX)

    • Co-immunoprecipitation followed by mass spectrometry

  • Gene knockout/knockdown experiments: Create deletion mutants in M. bovis or related mycobacteria and characterize phenotypic changes.

  • Complementation studies: Reintroduce the wild-type or mutated Mb2118c to knockout strains to confirm phenotype specificity.

What variables should be controlled when studying Mb2118c's effects on mycobacterial physiology?

When examining Mb2118c's impact on mycobacterial physiology, carefully control the following variables:

Variable TypeExamplesControl Method
Growth conditionsTemperature, media composition, pH, oxygen levelsStandardize across all experimental groups
Bacterial stateGrowth phase, cell density, passage numberUse cultures at consistent OD600 and passage number
Genetic backgroundStrain variations, spontaneous mutationsUse isogenic strains, whole-genome sequencing verification
Expression levelProtein concentration, induction timingQuantify expression levels, use inducible promoters
Environmental stressorsAntibiotics, nutrient limitation, oxidative stressApply stressors consistently or eliminate entirely

Document all experimental parameters thoroughly in your methods section, and validate protein expression levels via Western blot or other quantitative methods to ensure experimental consistency. For experiments involving multiple conditions, employ a factorial design to identify interaction effects between variables .

How can I design structure-function relationship studies for Mb2118c?

To investigate structure-function relationships in Mb2118c:

  • Computational structure prediction: Use AlphaFold or similar tools to predict protein structure.

  • Site-directed mutagenesis: Based on structural predictions, create:

    • Alanine scanning mutants of conserved residues

    • Domain deletion mutants

    • Point mutations of predicted catalytic residues

  • Functional assays: Develop specific assays based on hypothesized function, such as:

    • Enzymatic activity assays if catalytic function is suspected

    • Binding assays if protein-protein interactions are predicted

    • Stress response assays if involved in cellular protection

  • Structural validation: Consider X-ray crystallography, cryo-EM, or NMR for definitive structural characterization.

Compare wild-type and mutant proteins systematically, ensuring that mutations don't simply cause protein misfolding or degradation. Include positive and negative controls in all functional assays, and verify protein stability through circular dichroism or thermal shift assays .

How should I organize and track experimental data for Mb2118c characterization studies?

For efficient data management in Mb2118c research, implement a structured approach using data tables:

  • Create a comprehensive data management plan:

    • Define standardized file naming conventions

    • Establish directory structures for raw and processed data

    • Implement version control for analysis scripts

  • Design relational data tables that track:

    • Sample metadata (origin, preparation date, storage conditions)

    • Experimental conditions (temperatures, buffer compositions, incubation times)

    • Measurement data (absorbance values, gel images, spectroscopic readings)

    • Analysis results (calculated parameters, statistical outcomes)

  • Utilize cloud-based laboratory information management systems (LIMS) that allow:

    • Real-time collaboration

    • Sample tracking across experiments

    • Integration of results from different analytical methods

    • Secure data storage with appropriate backup

Remember that data tables should contain metadata links to the physical location of data files in cloud storage, rather than the actual data itself. This approach minimizes storage costs and reduces copying errors when sharing data with collaborators .

What statistical approaches are appropriate for analyzing Mb2118c functional data?

When analyzing functional data for Mb2118c, select statistical methods based on your experimental design:

Prior to analysis, address outliers through established criteria, and ensure all data transformations are clearly documented. Report effect sizes and confidence intervals alongside p-values to provide a complete statistical picture .

How can I integrate Mb2118c structural data with functional findings?

Integrating structural and functional data requires thoughtful analysis:

  • Map functional regions to structural elements:

    • Create structure-function correlation tables linking mutational effects to structural features

    • Use visualization software to highlight functional residues on 3D models

    • Generate conservation heatmaps overlaid on protein structure

  • Computational approaches:

    • Molecular dynamics simulations to understand protein flexibility

    • Docking studies to predict interaction partners

    • Energy calculations to evaluate stability of different conformational states

  • Data integration frameworks:

    • Develop unified databases linking experimental conditions to outcomes

    • Create network models connecting structure, interactions, and phenotypic effects

    • Use machine learning approaches to identify patterns across datasets

  • Validation strategies:

    • Design new mutations based on integrated models

    • Test predictions using orthogonal experimental approaches

    • Compare findings with homologous proteins from related species

When integrating diverse data types, maintain clear records of data provenance and processing methods to ensure reproducibility. Establish confidence metrics for predictions derived from integrated analyses .

How can genomic approaches inform our understanding of Mb2118c evolution?

Genomic approaches provide valuable insights into Mb2118c evolution:

  • Comparative genomics:

    • Identify orthologs across mycobacterial species

    • Analyze selective pressures through dN/dS ratio calculations

    • Examine synteny and genomic context conservation

  • Population genomics:

    • Characterize sequence variation in Mb2118c across M. bovis strains

    • Identify potential recombination events

    • Map strain-specific variations to functional domains

  • Phylogenetic analysis:

    • Construct gene trees to understand evolutionary history

    • Compare gene trees with species trees to detect horizontal gene transfer

    • Use Bayesian approaches to estimate divergence times

  • Genomic epidemiology:

    • Correlate Mb2118c variants with strain virulence or host specificity

    • Track transmission patterns based on gene variants

    • Identify potential adaptive mutations in different host environments

What are the challenges in studying protein-protein interactions involving uncharacterized proteins like Mb2118c?

Studying protein-protein interactions (PPIs) involving uncharacterized proteins presents several challenges:

  • Lack of prior knowledge:

    • Absence of known interaction partners limits targeted approaches

    • Difficulty in designing appropriate positive controls

    • Challenges in interpreting interaction significance

  • Technical limitations:

    • False positives in high-throughput screening methods

    • Expression and solubility issues with mycobacterial proteins

    • Limited sensitivity for detecting transient or weak interactions

  • Biological complexity:

    • Context-dependent interactions may be missed in vitro

    • Post-translational modifications may alter interaction profiles

    • Structural dynamics might influence binding properties

  • Validation requirements:

    • Need for orthogonal confirmation methods

    • Challenges in confirming biological relevance in vivo

    • Difficulty establishing specificity without known binding partners

To address these challenges:

  • Combine multiple complementary PPI detection methods

  • Develop appropriate negative controls using structurally similar proteins

  • Implement quantitative interaction measurements rather than binary outcomes

  • Consider membrane environments if Mb2118c is predicted to be membrane-associated

  • Validate interactions in mycobacterial systems rather than just heterologous hosts

How might Mb2118c contribute to mycobacterial pathogenesis based on current genomic knowledge?

While specific information about Mb2118c is limited, several approaches can help predict its potential role in pathogenesis:

  • Comparative analysis with virulence factors:

    • Sequence similarity to known virulence proteins

    • Presence of secretion signals or host-interaction domains

    • Conservation patterns across pathogenic and non-pathogenic mycobacteria

  • Expression pattern analysis:

    • Transcriptomic data showing regulation during infection

    • Induction under host-mimicking conditions (low pH, nutrient limitation)

    • Co-expression with established virulence genes

  • Structural predictions relevant to pathogenesis:

    • Presence of adhesin-like domains

    • Pore-forming or membrane-disrupting motifs

    • Host-protein mimicry regions

  • Genomic context clues:

    • Location within known pathogenicity islands

    • Proximity to genes involved in virulence

    • Evidence of horizontal transfer or selective pressure

  • Host response indicators:

    • Predicted epitopes for host immune recognition

    • Similarity to proteins inducing protective immunity

    • Potential for post-translational modifications that evade immunity

These predictions should guide experimental design, including infection models, immune response studies, and targeted mutagenesis approaches to definitively establish Mb2118c's role in pathogenesis .

What are the best approaches for producing antibodies against uncharacterized proteins like Mb2118c?

Generating antibodies against uncharacterized proteins requires strategic planning:

  • Antigen design considerations:

    • Use full-length protein for polyclonal antibodies if solubility permits

    • Select 2-3 peptide epitopes (15-20 amino acids) from predicted surface-exposed regions

    • Avoid regions with high sequence similarity to other mycobacterial proteins

    • Consider using both N-terminal and C-terminal regions for comprehensive detection

  • Production strategies:

    • Polyclonal antibodies: Good for detection, less specific but higher sensitivity

    • Monoclonal antibodies: Superior specificity, useful for distinguishing closely related proteins

    • Recombinant antibodies: Consistent production without batch variation

  • Validation requirements:

    • Confirm specificity against recombinant Mb2118c

    • Test cross-reactivity with related mycobacterial proteins

    • Validate in multiple applications (Western blot, immunofluorescence, ELISA)

    • Perform knockout/knockdown controls to confirm specificity

  • Application-specific considerations:

    • For immunoprecipitation: Target native epitopes rather than denatured regions

    • For immunofluorescence: Ensure antibodies recognize fixed/processed antigen forms

    • For ELISA: Develop paired antibodies recognizing different epitopes

Document all validation steps thoroughly to ensure reproducibility and reliable interpretation of results in subsequent experiments .

How can I develop reliable functional assays for an uncharacterized protein?

Developing functional assays for uncharacterized proteins like Mb2118c requires a systematic approach:

  • Hypothesis-driven design based on:

    • Sequence homology predictions

    • Structural similarity to characterized proteins

    • Genomic context and associated pathways

    • Expression patterns under various conditions

  • Assay categories to consider:

Functional CategoryAssay TypesDetection Methods
Enzymatic activitySubstrate conversion, Coupled enzyme reactionsSpectrophotometric, Fluorescence, HPLC
Protein bindingPull-down, Surface plasmon resonance, ELISAImmunoblotting, Fluorescence, Colorimetric
DNA/RNA bindingElectrophoretic mobility shift, Filter bindingRadiometric, Fluorescence
SignalingPhosphorylation state, Second messenger levelsWestern blot, ELISA, FRET-based sensors
Structural roleCellular morphology, Protein localizationMicroscopy, Fractionation
  • Validation strategies:

    • Include positive and negative controls

    • Test activity under varied conditions (pH, temperature, cofactors)

    • Confirm dose-dependence

    • Demonstrate specificity through competitive inhibition

    • Correlate activity with protein concentration

  • Optimization considerations:

    • Adjust buffer conditions systematically

    • Test multiple substrate concentrations

    • Determine time-dependency of reactions

    • Evaluate cofactor requirements

Begin with broader assays and refine based on initial results. Document all assay conditions meticulously to ensure reproducibility .

What bioinformatic pipelines are most effective for predicting functions of uncharacterized mycobacterial proteins?

For predicting functions of uncharacterized mycobacterial proteins like Mb2118c, implement a multi-layered bioinformatic approach:

  • Sequence-based analysis pipeline:

    • PSI-BLAST for distant homology detection

    • InterProScan for domain and motif identification

    • SignalP/TMHMM for subcellular localization signals

    • Phylogenetic profiling to identify co-evolving proteins

  • Structure-based prediction approaches:

    • AlphaFold2 for 3D structure prediction

    • DALI/TM-align for structural homology searches

    • CASTp for binding pocket identification

    • FTMap for functional site mapping

  • Systems biology integration:

    • Protein-protein interaction network analysis

    • Co-expression data mining from transcriptomic studies

    • Metabolic pathway gap analysis

    • Gene neighborhood conservation analysis

  • Machine learning applications:

    • Support Vector Machines for function classification

    • Random Forest approaches for multi-feature integration

    • Deep learning models for pattern recognition in protein sequences

  • Validation and confidence assessment:

    • Implement cross-validation strategies

    • Calculate statistical significance of predictions

    • Assign confidence scores to functional predictions

    • Consensus approaches combining multiple methods

For highest confidence, predictions should be consistent across multiple methods and supported by experimental data from related proteins. Document all parameters and software versions to ensure reproducibility of bioinformatic analyses .

What are the most promising research directions for further characterizing Mb2118c?

Future research on Mb2118c should prioritize:

  • Comprehensive structural characterization using X-ray crystallography or cryo-EM to definitively establish protein structure and potential functional sites.

  • Systematic interaction mapping using proximity labeling approaches in mycobacterial systems to identify physiologically relevant binding partners.

  • Conditional gene expression systems to understand the impact of Mb2118c depletion or overexpression on mycobacterial physiology under various stress conditions.

  • Comparative functional studies across pathogenic and non-pathogenic mycobacterial species to determine conservation of function and potential role in virulence.

  • Host-pathogen interaction studies examining potential roles in modulating host immune responses or adaptation to the intracellular environment.

These directions should be pursued with rigorous experimental design, appropriate controls, and integration of multiple data types to build a comprehensive understanding of this uncharacterized protein .

How might contradictory experimental results regarding Mb2118c function be reconciled?

When facing contradictory results in Mb2118c research:

  • Systematically assess experimental differences:

    • Compare protein preparation methods (tags, purification approaches)

    • Evaluate buffer compositions and assay conditions

    • Consider strain backgrounds and genetic modifications

    • Examine detection methods and their sensitivities

  • Consider biological explanations:

    • Multifunctional protein possibilities

    • Context-dependent activity

    • Post-translational modification effects

    • Conformational dynamics influencing function

  • Implement reconciliation strategies:

    • Design experiments that directly address the contradiction

    • Develop orthogonal approaches to test the same function

    • Collaborate with laboratories reporting different results

    • Consider independent validation by third parties

  • Data integration approaches:

    • Meta-analysis of all available data

    • Bayesian frameworks for evaluating evidence strength

    • Computational modeling to test compatibility of different findings

Contradictions often arise from differences in experimental conditions rather than fundamental disagreements about protein function. Thorough documentation and transparent reporting of all experimental parameters are essential for resolving such discrepancies .

How can researchers effectively collaborate on Mb2118c characterization across different specialties?

Effective cross-disciplinary collaboration for Mb2118c research requires:

  • Structured data sharing platforms:

    • Implement laboratory information management systems (LIMS)

    • Use standardized data formats and metadata annotation

    • Establish clear version control for protocols and analyses

    • Develop shared cloud repositories for raw data access

  • Communication frameworks:

    • Regular interdisciplinary meetings with defined objectives

    • Shared vocabulary documents to address discipline-specific terminology

    • Collaboration tools enabling real-time protocol adjustments

    • Visualization approaches for complex data accessible to all team members

  • Integrated experimental planning:

    • Design experiments that simultaneously address questions from multiple disciplines

    • Develop sample sharing workflows that maintain integrity

    • Implement quality control checkpoints relevant to all analytical approaches

    • Create decision trees for experimental progression

  • Knowledge synthesis strategies:

    • Regular review sessions integrating findings across disciplines

    • Collaborative writing platforms for manuscript development

    • Joint hypothesis generation incorporating diverse perspectives

    • Integrated data visualization approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.