Recombinant Uncharacterized protein Mb2226 (Mb2226)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Uncharacterized Protein Mb2226 (Mb2226)

Recombinant Uncharacterized Protein Mb2226 (Mb2226) is a bioengineered protein derived from Mycobacterium bovis, expressed in E. coli and fused with an N-terminal His-tag for purification and stability . With a full-length sequence spanning 230 amino acids (aa 1-230), this protein is classified under UniProt ID P64950 and is described as a hypothetical or uncharacterized protein in publicly available databases . Its primary role and functional mechanisms remain under investigation, though preliminary research suggests potential applications in vaccine development and pathogen studies .

Amino Acid Sequence

The protein’s sequence includes hydrophobic regions and motifs suggestive of membrane localization:
MPGPHSPNPGVGTNGPAPYPEPSSHEPQALDYPHDLGAAEPAFAPGPADDAALPPAAYPGVPPQVSYPKRRHKRLLIGIVVALALVSAMTAAIIYGVRTNGANTAGTFSEGPAKTAIQGYLNALENRDVDTIVRNALCGIHDGVRDKRSDQALAKLSSDAFRKQFSQVEVTSIDKIVYWSQYQAQVLFTMQVTPAAGGPPRGQVQGIAQLLFQRGQVLVCSYVLRTAGSY .

Research Applications and Potential Functions

While Mb2226 remains uncharacterized, its structural and expression features suggest roles in:

  • Membrane-Associated Processes: Predicted single-pass membrane protein localization .

  • Pathogen Interaction Studies: Linked to Mycobacterium survival mechanisms, with potential utility in vaccine development .

  • Protein-Protein Interactions: Hypothetical involvement in pathways requiring further validation .

No direct functional data (e.g., enzymatic activity, substrate binding) are currently available, highlighting the need for targeted biochemical assays .

Supplier Comparison

SupplierProduct Catalog NumberHost SystemPurityKey Features
Creative BioMartRFL7289MFE. coli≥90% (SDS-PAGE)His-tagged, Tris/PBS buffer, 6% trehalose
MyBioSourceMBS1056520E. coli/Yeast≥85% (SDS-PAGE)Flexible glycerol concentration
Creative BiolabsVAng-Yyj3063E. coli/Mammalian≥85% (SDS-PAGE)Partial-length variants available

Notes on Use

  • Handling: Avoid repeated freeze-thaw cycles; aliquot for long-term storage .

  • Applications: Restricted to in vitro research; not approved for diagnostic or therapeutic use .

Future Directions and Challenges

Mb2226’s uncharacterized status underscores the need for:

  1. Structural Analysis: X-ray crystallography or cryo-EM to elucidate conformational dynamics.

  2. Functional Screens: High-throughput assays to identify binding partners or enzymatic activity.

  3. Pathway Mapping: Integration with Mycobacterium bovis proteomics data to infer biological roles .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a particular tag, please inform us, and we will prioritize its incorporation.
Synonyms
BQ2027_MB2226; Uncharacterized protein Mb2226
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB2226
Target Protein Sequence
MPGPHSPNPGVGTNGPAPYPEPSSHEPQALDYPHDLGAAEPAFAPGPADDAALPPAAYPG VPPQVSYPKRRHKRLLIGIVVALALVSAMTAAIIYGVRTNGANTAGTFSEGPAKTAIQGY LNALENRDVDTIVRNALCGIHDGVRDKRSDQALAKLSSDAFRKQFSQVEVTSIDKIVYWS QYQAQVLFTMQVTPAAGGPPRGQVQGIAQLLFQRGQVLVCSYVLRTAGSY
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are optimal for Mb2226 recombinant protein production?

Mb2226 has been successfully expressed in several systems, with E. coli being the most commonly utilized for initial characterization studies. The optimal expression strategy depends on your specific research requirements:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coliRapid growth, high yield, cost-effectiveMay lack proper post-translational modifications>85% purity with His-tag purification
Mycobacterium smegmatisNative-like folding, proper modifications for mycobacterial proteinsSlower growth than E. coli, specialized vectors requiredImproved solubility for mycobacterial proteins
Cell-free expressionRapid production, avoids toxicity issuesHigher cost, potentially lower yieldVariable depending on optimization
Yeast/Baculovirus/MammalianMore complex post-translational modificationsHigher cost, longer production timeDependent on optimization

For most initial characterization studies, the E. coli system with N-terminal His-tag has proven effective for Mb2226, yielding protein with >90% purity as determined by SDS-PAGE .

What are recommended handling and storage conditions for recombinant Mb2226?

For optimal stability and activity preservation of recombinant Mb2226:

  • Reconstitution: Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Storage buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

  • Long-term storage: Add glycerol to 5-50% final concentration (50% recommended) and store in aliquots at -20°C/-80°C

  • Working aliquots: Can be stored at 4°C for up to one week

  • Avoid: Repeated freeze-thaw cycles as they significantly reduce protein stability

Before opening vials, briefly centrifuge to bring contents to the bottom. After reconstitution, the protein should be used promptly or properly aliquoted to prevent degradation through repeated freeze-thaw cycles.

How can I design efficient experiments to characterize the function of Mb2226?

When investigating an uncharacterized protein like Mb2226, a systematic experimental design approach is essential:

Factorial Experimental Design Strategy:

A factorial experimental design is recommended as it allows investigation of multiple factors simultaneously while minimizing the number of experiments required . For Mb2226 characterization:

  • Identify key variables to test:

    • Temperature (e.g., 25°C, 30°C, 37°C)

    • pH range (e.g., 5.5, 6.5, 7.5, 8.5)

    • Ionic strength conditions

    • Potential binding partners

    • Cell localization conditions

  • Design a Resolution V factorial experiment:
    For comprehensive analysis, use a Resolution V design that allows estimation of all main effects and two-way interactions separately . For example:

    Number of FactorsMinimum Runs for Resolution V
    3-416
    5-832
    9-1664
    17-32128
  • Implementation steps:

    • State the objective and hypotheses

    • Determine response variables (e.g., binding affinity, enzymatic activity)

    • Select appropriate factor levels

    • Randomize experimental runs to reduce systematic bias

    • Conduct experiments with appropriate controls

    • Use rigorous statistical analysis methods

This approach maximizes information obtained while minimizing resource utilization, crucial for efficiently studying proteins of unknown function.

What screening methods can effectively identify optimal Mb2226 recombinant protein producers?

For high-throughput screening of Mb2226 producers, MALDI-TOF MS provides an efficient semi-quantitative approach:

MALDI-TOF MS Screening Protocol:

  • Clone selection workflow:

    • Transfer isolated colonies to gridded Petri dishes with agarose-containing LB supplemented with IPTG

    • After 4 hours of induction, perform mass spectrometric analysis

    • Select clones with maximum intensity values of peaks corresponding to Mb2226

    • Transfer selected clones to liquid medium for scale-up

  • Semi-quantitative assessment:

    • The relationship between concentration and peak intensity follows a linear model (R² = 0.8147)

    • For Mb2226, normalize values against host cell proteins (like RL33) to account for extraction variability

    • Compare peak intensities between induced and non-induced samples to confirm expression

  • Advantages over traditional methods:

    • Higher throughput than Western blotting

    • Greater specificity compared to visual screening methods

    • Can analyze hundreds of colonies rapidly

    • No need for specific antibodies

This approach allows efficient selection of high-expressing clones before committing to larger-scale production efforts.

How can I analyze contradictory data in Mb2226 functional studies?

When facing contradictory results in Mb2226 characterization studies, a systematic approach using contradiction detection methodology is recommended:

  • Identify the nature of contradictions:

    • Data contradictions (e.g., different activity measurements)

    • Interpretation contradictions (e.g., different functional assignments)

    • Methodological contradictions (e.g., different expression systems yielding different results)

  • Apply a structured contradiction analysis framework:

    • Categorize contradictions by type: negation, antonymy, or numeric mismatch

    • Develop prototypical contradiction statements that clearly articulate the conflict

    • Use linguistic rules to dissect the logical structure of contradictory claims

  • Resolution strategies:

    • Design validation experiments specifically targeting the contradiction

    • Implement cross-validation of methods to identify method-dependent artifacts

    • Consider Bayesian experimental design to systematically narrow uncertainty

    • Evaluate experimental conditions for subtle differences that might explain discrepancies

  • Statistical approaches for contradiction resolution:

    • Apply meta-analysis techniques to integrate conflicting results

    • Use cross-entropy estimators to quantify the information value of contradictory data

    • Implement non-parametric statistical tests when parametric assumptions may be violated

By systematically analyzing contradictions, you can transform apparent conflicts into valuable insights about the context-dependent behavior of Mb2226.

What statistical methods are most appropriate for analyzing Mb2226 functional assay data?

The appropriate statistical analysis for Mb2226 functional studies depends on your experimental design and data characteristics:

Statistical Analysis Decision Framework:

  • For comparing expression conditions (e.g., different expression systems):

    • For normally distributed data: ANOVA followed by post-hoc tests

    • For non-normal data: Kruskal-Wallis or Wilcoxon rank tests

    • Include effect size measurements (not just p-values) to quantify the magnitude of differences

  • For complex experimental designs (multiple factors affecting Mb2226 function):

    • Factorial ANOVA to assess main effects and interactions

    • ANCOVA when controlling for covariates

    • Use Resolution V designs to distinguish between main effects and interactions

  • For predictive modeling of Mb2226 function:

    • Linear regression for continuous outcomes with linear relationships

    • Generalized linear models for non-normal distributions

    • Nonlinear models when relationships cannot be linearized

  • For handling variability:

    • Control experimental variability through standardized procedures

    • Use bootstrap or permutation tests for robust inference

    • Consider Bayesian approaches for incorporating prior knowledge

  • Important considerations:

    • Statistical power calculations to ensure adequate sample sizes

    • Validation of statistical assumptions before analysis

    • Correction for multiple comparisons when performing numerous tests

    • Cross-validation to assess model robustness

Remember that statistical significance (p < 0.05) alone is insufficient - biological significance and effect size are equally important considerations when interpreting results from Mb2226 functional studies.

How can I optimize purification strategies for His-tagged Mb2226?

For optimal purification of His-tagged Mb2226 from expression systems:

Purification Optimization Protocol:

  • Cell lysis optimization:

    • For E. coli: Use sonication in Tris/PBS-based buffer, pH 8.0 with protease inhibitors

    • For mycobacterial expression: Consider specialized lysis buffers containing detergents suitable for mycobacterial cell walls

  • IMAC purification parameters to optimize:

    ParameterRecommendation for Mb2226Rationale
    Binding bufferTris/PBS with 10-20 mM imidazole, pH 8.0Reduces non-specific binding
    Wash stringencyGradient of 20-50 mM imidazoleRemoves weakly bound contaminants
    Elution conditions250-300 mM imidazoleComplete elution while maintaining structure
    Flow rateSlow flow (0.5-1 ml/min)Ensures complete binding of His-tagged protein
    Column volume1-5 ml for typical expression scaleAdequate capacity for expressed protein
  • Post-purification processing:

    • Buffer exchange to remove imidazole using dialysis or desalting columns

    • Concentration determination by absorbance at 280nm or Bradford assay

    • Quality assessment by SDS-PAGE (aim for >90% purity)

    • Consider tag removal if it interferes with functional studies

  • Storage considerations:

    • Add 6% trehalose as a stabilizing agent

    • Aliquot and store with 50% glycerol at -80°C

    • Avoid repeated freeze-thaw cycles

This systematic approach should yield high-purity Mb2226 suitable for downstream structural and functional analyses.

What approaches can elucidate potential interactions between Mb2226 and other mycobacterial proteins?

To investigate protein-protein interactions involving Mb2226:

Interaction Analysis Strategy:

  • In silico prediction approaches:

    • Sequence-based prediction of interaction domains

    • Structural modeling to identify potential interaction interfaces

    • Comparative analysis with known mycobacterial membrane proteins

  • Experimental verification methods:

    MethodApplication to Mb2226AdvantagesLimitations
    Co-immunoprecipitationPull-down of Mb2226 complexes from mycobacterial lysatesIdentifies natural complexesRequires specific antibodies
    Bacterial two-hybridScreening Mb2226 against mycobacterial libraryHigh-throughput screeningPotential false positives/negatives
    Surface plasmon resonanceDirect binding analysis with purified proteinsQuantitative binding kineticsRequires purified interaction partners
    Cross-linking coupled with MSIdentification of proximal proteins in native environmentCaptures transient interactionsComplex data analysis
  • Validation of interactions:

    • Reciprocal pull-downs with identified partners

    • Mutagenesis of predicted interaction sites

    • Functional assays to determine biological relevance

    • Localization studies to confirm co-localization in cells

  • Data analysis considerations:

    • Apply appropriate statistical tests for interaction significance

    • Use control proteins to filter out non-specific interactions

    • Consider protein abundance when interpreting results

    • Integrate with existing mycobacterial interactome data

This multi-faceted approach provides robust evidence for potential interacting partners of Mb2226 and insights into its functional role in Mycobacterium bovis.

How can I develop a Bayesian sequential experiment design to efficiently characterize Mb2226 function?

For efficient function discovery of uncharacterized proteins like Mb2226, Bayesian sequential experiment design offers a powerful approach:

Bayesian Experimental Design Framework:

  • Initial model formulation:

    • Define prior probabilities for potential functions of Mb2226

    • Incorporate known information about mycobacterial membrane proteins

    • Create a joint model distribution over possible functions and experimental outcomes

  • Sequential experiment selection:

    • Use cross-entropy estimators rather than traditional expected information gain (EIG)

    • This approach overcomes the exponential sample complexity of traditional methods

    • Optimize experiment selection based on potential information gain:

    Information Gain=H(θ)H(θye)\text{Information Gain} = H(\theta) - H(\theta|y_e)

    Where H(θ)H(\theta) is the prior entropy and H(θye)H(\theta|y_e) is the expected posterior entropy after experiment ee

  • Implementation strategy:

    • Start with broad functional assays (membrane localization, basic biochemical properties)

    • Update function probabilities after each experiment using Bayes' rule

    • Select subsequent experiments that maximize information gain

    • Continue until converging on high-probability function assignments

  • Practical considerations:

    • Use reinforcement learning algorithms to learn amortized design policies

    • Employ flexible proposal distributions to approximate the true posterior

    • Handle continuous and discrete experimental parameters

    • Accommodate non-differentiable likelihoods and implicit models

This approach systematically reduces uncertainty about Mb2226 function while minimizing experimental resources, providing an efficient path to characterization of this uncharacterized protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.