Recombinant Uncharacterized protein Mb2261 (Mb2261)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
BQ2027_MB2261; Uncharacterized protein Mb2261
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB2261
Target Protein Sequence
MLLPAANVIMQLAVPGVGYGVLESPVDSGNVYKHPFKRARTTGTYLAVATIGTESDRALI RGAVDVAHRQVRSTASSPVSYNAFDPKLQLWVAACLYRYFVDQHEFLYGPLEDATADAVY QDAKRLGTTLQVPEGMWPPDRVAFDEYWKRSLDGLQIDAPVREHLRGVASVAFLPWPLRA VAGPFNLFATTGFLAPEFRAMMQLEWSQAQQRRFEWLLSVLRLADRLIPHRAWIFVYQLY LWDMRFRARHGRRIV
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mb2261 and what organism produces it?

Mb2261 is an uncharacterized protein encoded by the Mb2261 gene in Mycobacterium bovis. It is a full-length protein consisting of 255 amino acids and is available as a recombinant His-tagged protein expressed in E. coli for research purposes . To study this protein, researchers typically employ recombinant DNA technology to clone the gene into expression vectors, followed by protein purification using affinity chromatography methods that leverage the His-tag. The protein's uncharacterized status indicates that its biological function and structural characteristics remain largely unknown, necessitating further investigation through biochemical and structural biology approaches.

What is known about the genomic context of Mb2261?

The Mb2261 gene has been identified as a locus of interest in genomic studies of M. bovis strains. It contains single nucleotide polymorphisms (SNPs) that vary between different strains, particularly an A/G polymorphism observed in specific isolates (16158 and 23217) . To investigate its genomic context, researchers would need to perform comparative genomic analyses using whole genome sequencing data from multiple M. bovis strains. This would involve alignment of sequences around the Mb2261 locus to identify conserved regions, regulatory elements, and potential operons that might provide clues about the protein's function within the bacterium's biology.

How does Mb2261 compare to homologous proteins in other mycobacterial species?

While specific homology data is not provided in the search results, researchers interested in this question would need to conduct thorough bioinformatic analyses. The methodology would involve sequence alignment using tools like BLAST against mycobacterial protein databases, followed by phylogenetic analysis to establish evolutionary relationships. Structural prediction algorithms could then be applied to identify conserved domains that might suggest functional roles. Of particular interest would be comparisons with M. tuberculosis proteins, given the close relationship between M. bovis and M. tuberculosis within the Mycobacterium tuberculosis complex (MTBC).

What specific SNPs have been identified in the Mb2261 gene?

The Mb2261 gene has been identified to contain an A/G polymorphism at a specific locus. According to the research data, this polymorphism shows consistency across different strain classification groups (SCGs), with the nucleotide being "A" in SCG-1 and SCG-2 groups, while presenting as "A/G" in the SCG-3 group . This variation appears to be relatively rare, as it was observed in only two isolates (16158 and 23217) according to the footnote in the data table . To detect such SNPs, researchers typically use methods like PCR amplification followed by sequencing, or targeted genotyping approaches such as the iPLEX assay mentioned in the search results, which can detect specific single nucleotide base changes .

How can SNPs in Mb2261 be used for strain typing of M. bovis?

SNPs in genes like Mb2261 can serve as molecular markers for strain differentiation and epidemiological tracking of M. bovis. The methodology for utilizing these SNPs involves designing multiplexed assays capable of detecting multiple SNP sites simultaneously, such as the iPLEX assay mentioned in the research . When integrated with other typing methods like spoligotyping (which was used to characterize the isolates in the research), these SNP markers can provide high-resolution strain differentiation. For Mb2261 specifically, the A/G polymorphism could be incorporated into SNP panels designed to distinguish between closely related M. bovis strains, particularly those belonging to different SCG groups .

What methodological approaches are recommended for analyzing SNP patterns across the M. bovis genome, including the Mb2261 locus?

For comprehensive SNP analysis across the M. bovis genome, researchers should employ a multi-tiered approach that combines whole genome sequencing with targeted SNP profiling. The research methodology demonstrated in the search results involved selecting SNPs from both coding (n=44) and intergenic (n=306) regions that showed diversity among M. bovis isolates . For targeted SNP detection, multiplexed iPLEX assays were designed to detect up to 350 single nucleotide base changes . The analysis should include verification of SNP positions against reference genomes like M. bovis strain AF2122/97 and comparison with M. tuberculosis strains H37Rv and CDC1551 . When analyzing the Mb2261 locus specifically, researchers should compare the SNP patterns with epidemiological data to determine if correlations exist between genetic variations and outbreak patterns or geographical distribution.

What are the recommended protocols for expressing and purifying recombinant Mb2261?

Based on available information, recombinant Mb2261 protein can be successfully expressed in E. coli with a His-tag . The recommended expression protocol would involve:

  • Cloning the Mb2261 gene into a suitable expression vector containing a His-tag sequence

  • Transforming the construct into an E. coli expression strain optimized for mycobacterial proteins

  • Inducing protein expression under controlled conditions (temperature, inducer concentration, time)

  • Cell lysis using methods appropriate for mycobacterial proteins (sonication or pressure-based disruption)

  • Purification via nickel affinity chromatography, leveraging the His-tag

  • Quality control assessment through SDS-PAGE and Western blotting

To ensure proper folding, researchers might need to optimize conditions by testing various buffer systems, considering the addition of chaperones, or exploring refolding protocols if the protein forms inclusion bodies. Purification yields and protein stability would need to be carefully monitored throughout the process.

How can functional assays be designed to characterize an uncharacterized protein like Mb2261?

Designing functional assays for uncharacterized proteins requires a systematic approach:

  • Bioinformatic prediction: Utilize structure prediction algorithms to identify potential functional domains

  • Binding partner identification: Employ pull-down assays, yeast two-hybrid systems, or co-immunoprecipitation to identify protein-protein interactions

  • Enzymatic activity screening: Test the purified protein against various substrates based on predicted functions

  • Crystallization and structural analysis: Determine the three-dimensional structure to gain insights into potential functions

  • Gene knockout/knockdown studies: Generate M. bovis strains with altered Mb2261 expression to observe phenotypic changes

  • Transcriptomic analysis: Compare gene expression profiles between wild-type and Mb2261-modified strains

  • Growth condition variation: Test how different environmental conditions affect Mb2261 expression

For Mb2261 specifically, the assays should be designed considering its potential involvement in M. bovis pathogenicity or survival mechanisms, given the bacterium's significance in tuberculosis research.

What challenges might researchers encounter when working with Mb2261 and how can they be addressed?

Researchers working with uncharacterized proteins like Mb2261 face several challenges:

  • Expression difficulties: Mycobacterial proteins often exhibit poor expression in heterologous systems. This can be addressed by optimizing codon usage, testing different expression strains, or using mycobacterial expression systems.

  • Solubility issues: Recombinant proteins may form inclusion bodies. Solutions include adjusting expression conditions (lower temperature, reduced inducer concentration), adding solubility tags, or developing refolding protocols.

  • Functional assessment: Without known activity, designing appropriate assays is challenging. A systematic approach using structural predictions and homology-based hypotheses can guide assay development.

  • Post-translational modifications: If Mb2261 requires specific modifications not occurring in E. coli, expression in more suitable systems (mycobacterial or eukaryotic) might be necessary.

  • Stability concerns: Purified protein may exhibit limited stability. Buffer optimization, storage condition testing, and the addition of stabilizing agents can help maintain protein integrity.

  • Structural determination: Obtaining crystal structures may be difficult. Alternative approaches like NMR spectroscopy or cryo-electron microscopy could be considered.

How might genetic variations in Mb2261 contribute to strain-specific phenotypes of M. bovis?

The A/G polymorphism observed in Mb2261 could potentially influence strain-specific phenotypes through several mechanisms:

  • If the SNP is non-synonymous (causing an amino acid change), it might alter protein structure or function

  • Even synonymous changes could affect translation efficiency or mRNA stability

  • SNPs in regulatory regions could impact gene expression levels

To investigate these possibilities, researchers would need to:

  • Determine if the A/G polymorphism results in an amino acid substitution

  • Compare phenotypic characteristics between strains with different Mb2261 alleles

  • Measure Mb2261 expression levels across different strains

  • Generate isogenic strains differing only at the Mb2261 locus through genetic engineering

  • Assess how the polymorphism affects interactions with host cells or survival under various stress conditions

This approach would help establish whether the observed genetic variation correlates with functional differences that might contribute to virulence, host adaptation, or antibiotic resistance.

What bioinformatic approaches can be used to predict potential functions of Mb2261?

Predicting functions of uncharacterized proteins like Mb2261 requires sophisticated bioinformatic approaches:

  • Sequence-based analysis:

    • Homology detection using sensitive sequence comparison tools (PSI-BLAST, HHpred)

    • Identification of conserved domains using databases like Pfam and InterPro

    • Detection of sequence motifs associated with specific functions

  • Structural prediction:

    • Ab initio structure prediction using tools like AlphaFold or Rosetta

    • Comparison with structural databases to identify similar folding patterns

    • Active site prediction based on structural features

  • Genomic context analysis:

    • Examination of neighboring genes in the M. bovis genome

    • Investigation of co-expression patterns with genes of known function

    • Identification of conserved gene clusters across mycobacterial species

  • Network-based approaches:

    • Construction of protein-protein interaction networks based on experimental data

    • Functional prediction based on interaction partners

    • Pathway enrichment analysis to identify biological processes

These analyses should be integrated to generate testable hypotheses about Mb2261's potential role in M. bovis biology and pathogenesis.

How could Mb2261 be utilized in developing diagnostic tools for M. bovis infections?

The SNP variation in Mb2261 could be leveraged for diagnostic purposes, particularly in molecular typing approaches for M. bovis. A comprehensive diagnostic strategy might include:

  • Development of SNP-based molecular assays:

    • Design of PCR primers targeting the Mb2261 locus

    • Creation of multiplex assays that include the A/G polymorphism along with other informative SNPs

    • Integration into existing typing systems like spoligotyping for enhanced discrimination

  • Serological approaches:

    • Production of antibodies against recombinant Mb2261

    • Development of immunoassays to detect Mb2261 or anti-Mb2261 antibodies in infected hosts

    • Evaluation of strain-specific epitopes that might differ due to the SNP variation

  • Incorporation into genomic diagnostic panels:

    • Design of comprehensive SNP panels that include Mb2261 for strain typing

    • Development of bioinformatic pipelines for analyzing whole genome sequencing data with focus on informative loci like Mb2261

    • Correlation of strain types with epidemiological data for outbreak tracking

Successful implementation would require validation against well-characterized M. bovis isolates from various hosts and geographical regions to ensure diagnostic specificity and sensitivity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.