Recombinant Uncharacterized protein Mb2296 (Mb2296)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requests. Please specify your preferred format in the order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
The shelf life of our products is influenced by factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize the development of your specified tag.
Synonyms
BQ2027_MB2296; Uncharacterized protein Mb2296
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB2296
Target Protein Sequence
MNRHSTAASDRGLQAERTTLAWTRTAFALLVNGVLLTLKDTQGADGPAGLIPAGLAGAAA SCCYVIALQRQRALSHRPLPARITPRGQVHILATAVLVLMVVTAFAQLL
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and basic properties of Mb2296 protein?

Mb2296 is an uncharacterized protein from Mycobacterium bovis with 109 amino acids (full length). Its amino acid sequence is: MNRHSTAASDRGLQAERTTLAWTRTAFALLVNGVLLTLKDTQGADGPAGLIPAGLAGAAASCCYVIALQRQRALSHRPLPARITPRGQVHILATAVLVLMVVTAFAQLL . The protein has a UniProt ID of P64972 and is also known by the synonym BQ2027_MB2296 . Structural analysis suggests the presence of hydrophobic regions that may indicate membrane association, particularly in the C-terminal portion of the sequence.

How do you differentiate between the native and recombinant forms of Mb2296?

The recombinant form of Mb2296 typically contains affinity tags (most commonly His-tag) that facilitate purification and detection, which are absent in the native form . The recombinant protein expressed in E. coli systems also exhibits post-translational modifications different from those in Mycobacterium bovis. To distinguish between native and recombinant forms, researchers should employ:

  • Western blotting with tag-specific antibodies

  • Mass spectrometry to identify tag-specific peptides

  • Size-exclusion chromatography to detect size differences due to added tags

  • N-terminal sequencing to confirm the presence of fusion tags

What expression systems are most suitable for Mb2296 production?

The E. coli expression system is the most documented and validated system for Mb2296 production . The protein is typically expressed as a fusion with an N-terminal His-tag for purification purposes. The pET vector system utilizing T7 promoters has been shown to be particularly effective for mycobacterial proteins, with potential protein yields reaching up to 50% of total cellular protein under optimized conditions .

For higher expression levels, researchers should consider:

  • BL21-Gold (DE3) E. coli strain, which has shown better enrichment factors compared to XL-1 strains in similar proteins

  • T7 promoter-based expression vectors (pET series) with IPTG induction

  • Temperature optimization (typically 18°C for overnight expression to enhance solubility)

How can N-terminal modifications improve Mb2296 expression yield?

Advanced optimization of Mb2296 expression can be achieved through N-terminal sequence modifications. Research has demonstrated that adding specific amino acid sequences to the N-terminus can significantly enhance protein yield.

The MSKIK N-terminal sequence has been documented to improve expression of recombinant proteins, likely by preventing or releasing ribosomal stalling . For Mb2296 specifically, implementing a FACS-based screening approach with a GFP reporter fusion can identify optimal N-terminal sequences that increase yield up to 30-fold in some protein constructs .

Methodology for N-terminal optimization:

  • Create randomized N-terminal sequence libraries fused to Mb2296

  • Include a C-terminal GFP reporter for fluorescence detection

  • Transform into expression hosts (preferably BL21-Gold DE3)

  • Perform FACS sorting to isolate high-expressing clones

  • Validate enrichment via SDS-PAGE analysis

What are the optimal codon optimization strategies for Mb2296 expression?

Codon optimization can significantly impact Mb2296 expression levels. In studies with similar recombinant proteins, codon optimization alone has increased yield over 4-fold, and when combined with N-terminal sequence manipulation, yields increased up to 30-fold .

For Mb2296, consider these methodological approaches:

  • Analyze the native sequence for rare codons in E. coli using tools like the GenScript codon optimization tool

  • Optimize the 5' mRNA structure to minimize secondary structures that could impede translation initiation

  • Pay particular attention to the initial codons after the start codon, as these significantly impact expression levels

  • Consider using the TISIGNER bioinformatics tool to design optimal initial codons while maintaining the amino acid sequence

  • Implement the optimized sequence in experimental validation using comparative expression analysis

What is the most efficient purification protocol for His-tagged Mb2296?

The His-tagged Mb2296 can be purified using immobilized metal affinity chromatography (IMAC) with the following optimized protocol:

  • Harvest cells after expression (typically after 16-18 hours at 18°C)

  • Lyse cells in a suitable buffer (typically Tris-based, pH 8.0)

  • Clarify lysate by centrifugation at 20,000 × g for 30 minutes

  • Apply supernatant to Ni-NTA resin pre-equilibrated with lysis buffer

  • Wash extensively with buffer containing 20-40 mM imidazole

  • Elute purified protein with buffer containing 250-300 mM imidazole

  • Dialyze against storage buffer (Tris/PBS-based buffer, pH 8.0 with 6% trehalose)

The purity of Mb2296 obtained through this method typically exceeds 90% as determined by SDS-PAGE analysis .

How can solubility issues with Mb2296 be addressed during purification?

Advanced researchers frequently encounter solubility challenges with membrane-associated proteins like Mb2296. To address these issues, implement the following methodological approaches:

  • Expression temperature optimization: Lower the expression temperature to 18°C to enhance proper folding

  • Co-expression with chaperones: Consider co-expressing with folding chaperones like GroEL/GroES

  • Solubility tags: Fusion with solubility-enhancing tags such as GST or MBP

  • Detergent screening: Systematic testing of detergents (CHAPS, DDM, Triton X-100) at varying concentrations

  • Buffer optimization: Screen various buffer compositions, including:

Buffer ComponentRange to TestOptimal for Mb2296
pH6.0-9.08.0
NaCl100-500 mM300 mM
Glycerol5-20%10%
Reducing agents1-10 mM DTT/BME5 mM DTT
Stabilizing agentsVarious6% Trehalose
  • Limited proteolysis: Identify and remove aggregation-prone regions

For refolding of Mb2296 from inclusion bodies, a stepwise dialysis approach with gradually decreasing denaturant concentration has shown promising results in similar mycobacterial proteins.

What analytical techniques are most informative for characterizing Mb2296?

For comprehensive characterization of Mb2296, researchers should employ multiple complementary techniques:

  • SDS-PAGE: Assess purity and apparent molecular weight (expected ~12 kDa plus tag size)

  • Western blotting: Confirm identity using anti-His antibodies or custom antibodies against Mb2296

  • Mass spectrometry: Determine precise molecular weight and verify sequence integrity

  • Circular dichroism (CD): Analyze secondary structure elements

  • Size-exclusion chromatography: Evaluate oligomeric state and homogeneity

  • Dynamic light scattering: Assess size distribution and potential aggregation

  • Thermal shift assays: Determine protein stability under various conditions

For membrane association studies, consider:

  • Liposome binding assays

  • Detergent partitioning experiments

  • Hydrophobic interaction chromatography

How can researchers investigate potential functions of this uncharacterized protein?

As Mb2296 remains uncharacterized, a systematic approach to functional investigation includes:

  • Bioinformatic analysis:

    • Sequence homology comparison with characterized proteins

    • Structural prediction using tools like AlphaFold2

    • Domain identification and motif recognition

    • Genomic context analysis to identify functional relationships

  • Experimental approaches:

    • Pull-down assays to identify interaction partners

    • Yeast two-hybrid screening for protein-protein interactions

    • Knockout/knockdown studies in Mycobacterium to observe phenotypic effects

    • Localization studies using fluorescent protein fusions or immunofluorescence

    • Functional complementation experiments

  • Advanced structural studies:

    • X-ray crystallography

    • Nuclear magnetic resonance (NMR) spectroscopy

    • Cryo-electron microscopy

What are the optimal storage conditions for purified Mb2296?

Purified Mb2296 requires specific storage conditions to maintain stability and activity. Based on experimental data, the following protocol is recommended:

  • Short-term storage: Store working aliquots at 4°C for up to one week

  • Long-term storage: Store at -20°C or -80°C in small aliquots to avoid repeated freeze-thaw cycles

  • Lyophilization: For extended stability, lyophilization in the presence of stabilizers (e.g., trehalose) is effective

For reconstitution of lyophilized Mb2296:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Aliquot and store at -20°C/-80°C

How can thermal and chemical stability of Mb2296 be assessed and improved?

To thoroughly characterize and enhance Mb2296 stability:

  • Perform differential scanning fluorimetry (DSF) to determine melting temperatures (Tm) under various conditions

  • Conduct accelerated stability studies at elevated temperatures (4°C, 25°C, 37°C, 42°C)

  • Monitor aggregation propensity using dynamic light scattering over time

  • Evaluate the effects of various excipients on stability:

Excipient ClassExamplesTypical Concentration Range
SugarsTrehalose, sucrose5-10%
PolyolsGlycerol, sorbitol5-20%
Amino acidsArginine, glycine50-100 mM
SurfactantsPolysorbate 80, 200.01-0.1%
SaltsNaCl, (NH₄)₂SO₄100-500 mM
  • Implement protein engineering approaches such as:

    • Surface charge optimization

    • Disulfide bond introduction

    • Glycosylation site addition (for eukaryotic expression systems)

    • Stabilizing mutation identification through computational design

How can researchers address low expression yields of Mb2296?

When facing low expression yields, implement this systematic troubleshooting approach:

  • Optimize expression conditions:

    • Test multiple E. coli strains (BL21-Gold DE3 has shown better enrichment for similar proteins compared to XL-1)

    • Vary induction parameters (IPTG concentration, induction time, culture density at induction)

    • Screen expression temperatures (18°C, 25°C, 30°C, 37°C)

  • Enhance expression constructs:

    • Implement N-terminal sequence optimization using FACS-based approaches

    • Consider the MSKIK N-terminal sequence which has been shown to enhance protein yield

    • Apply codon optimization strategies for E. coli expression

    • Test alternative promoter systems (T7, trc, araBAD)

  • Implement advanced molecular techniques:

    • Co-express with rare tRNA plasmids (pRARE)

    • Apply N-terminal sequence libraries with GFP reporters for high-throughput screening

    • Use FACS to isolate high-expressing clones, which has shown up to 30-fold improvement in yield for some proteins

What strategies can address inclusion body formation with Mb2296?

To manage inclusion body formation during Mb2296 expression:

  • Prevention strategies:

    • Lower expression temperature to 18°C for overnight expression

    • Reduce inducer concentration

    • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

    • Fusion with solubility-enhancing tags (GST, MBP, SUMO)

  • Recovery strategies:

    • Optimize inclusion body isolation through differential centrifugation

    • Implement a refolding protocol:

StepProcedureParameters
SolubilizationDenature in 8M urea or 6M guanidine HClpH 8.0, 5 mM DTT
PurificationIMAC under denaturing conditionsLinear imidazole gradient
RefoldingDialysis or dilutionGradual denaturant removal
PolishingSize exclusion chromatographyRemove aggregates
  • On-column refolding:

    • Bind denatured protein to Ni-NTA under denaturing conditions

    • Gradually decrease denaturant concentration while protein remains bound

    • Elute refolded protein with imidazole

How can researchers design experiments to investigate Mb2296's potential role in Mycobacterium bovis?

To systematically investigate Mb2296's biological function:

  • Gene knockout studies:

    • Create Mb2296 deletion mutants in M. bovis

    • Perform comparative phenotypic analyses (growth rates, morphology, virulence)

    • Conduct complementation studies to confirm phenotype specificity

  • Transcriptomic and proteomic analyses:

    • Compare wild-type and Mb2296 knockout strains

    • Identify genes/proteins with altered expression

    • Map potential regulatory networks

  • Localization studies:

    • Generate fluorescent protein fusions

    • Employ immunogold electron microscopy

    • Perform subcellular fractionation and Western blotting

  • Interaction partner identification:

    • Conduct pull-down assays with purified Mb2296-His

    • Perform bacterial two-hybrid screening

    • Use crosslinking mass spectrometry (XL-MS)

  • Structural biology approaches:

    • Determine crystal structure

    • Implement molecular dynamics simulations

    • Identify potential binding pockets or active sites

What comparative analysis approaches can be used to understand Mb2296's evolutionary significance?

For evolutionary significance assessment, researchers should:

  • Perform comprehensive phylogenetic analysis:

    • Identify homologs across mycobacterial species

    • Construct phylogenetic trees to trace evolutionary relationships

    • Calculate selection pressures (dN/dS ratios)

  • Conduct comparative genomics:

    • Analyze gene neighborhood conservation

    • Identify syntenic regions across species

    • Examine co-evolution with functionally related genes

  • Implement structural comparative analysis:

    • Compare predicted structures with homologous proteins

    • Identify conserved structural elements

    • Map conservation onto three-dimensional structures

  • Functional conservation testing:

    • Express homologs from different species

    • Test functional complementation in knockout models

    • Compare biochemical properties across homologs

This evolutionary approach may reveal conserved functions that have been maintained through selective pressure, potentially indicating essential roles in mycobacterial physiology or pathogenesis.

How can researchers integrate Mb2296 studies into broader systems biology frameworks?

To position Mb2296 research within systems biology:

  • Network integration approaches:

    • Map protein-protein interactions involving Mb2296

    • Identify metabolic pathways potentially affected by Mb2296

    • Construct regulatory networks incorporating Mb2296

  • Multi-omics data integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Implement computational models to predict system-wide effects

    • Apply machine learning for pattern recognition across datasets

  • Functional genomics strategies:

    • Conduct high-throughput phenotypic screening of Mb2296 mutants

    • Implement CRISPRi for controlled gene repression

    • Analyze epistatic interactions with other genes

  • Mathematical modeling:

    • Develop kinetic models of pathways involving Mb2296

    • Simulate cellular responses under various conditions

    • Predict emergent behaviors at the system level

This integrative approach can reveal non-obvious relationships and contextual importance of Mb2296 within the complex biology of Mycobacterium bovis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.