Recombinant Uncharacterized protein Mb2601c (Mb2601c)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Origin

Mb2601c is encoded by Mycobacterium bovis (strain ATCC BAA-935/AF2122/97), with gene locus BQ2027_MB2601C . As a recombinant protein, it retains the native sequence (partial or full-length) while being fused to purification tags like His for laboratory applications . Key identifiers include:

PropertyDetails
UniProt IDNot explicitly listed (related Mb2665c: P65034)
Amino Acid CompositionEnriched in alanine, valine, and leucine residues
Structural FeaturesPredicted transmembrane domains

Recombinant Production Systems

Multiple expression platforms have been employed for Mb2601c synthesis:

While functionally uncharacterized, bioinformatic analyses suggest:

  • Potential involvement in transmembrane transport due to hydrophobic domain architecture

  • Structural similarities to other mycobacterial proteins involved in virulence or antibiotic resistance

  • Possible antigenic properties given Mycobacterium bovis' pathogenic relevance

Research Applications

Current uses focus on:

  • Antibody Production: Serve as immunogen for tuberculosis-related studies

  • Structural Biology: Crystallization trials using purified recombinant protein

  • Comparative Genomics: Functional annotation efforts for uncharacterized mycobacterial proteins

Challenges and Knowledge Gaps

Key limitations include:

  • Absence of enzymatic or binding activity data

  • Unresolved tertiary structure

  • Lack of in vivo functional validation studies

This protein exemplifies the broader challenge of characterizing ~48 million hypothetical proteins in genomic databases , emphasizing the need for advanced proteomic and CRISPR-based functional screening approaches .

Future Directions

Priority research areas include:

  • Interaction partner screening via yeast two-hybrid

  • Subcellular localization studies

  • Knockout strain phenotyping in Mycobacterium models

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
BQ2027_MB2601C; Uncharacterized protein Mb2601c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB2601C
Target Protein Sequence
MSASLLVRTACGGRAVAQRLRTVLWPITQTSVVAGLAWYLTHDVFNHPQAFFAPISAVVC MSATNVLRARRAQQMIVGVALGIVLGAGVHALLGSGPIAMGVVVFIALSVAVLCARGLVA QGLMFINQAAVSAVLVLVFASNGSVVFERLFDALVGGGLAIVFSILLFPPDPVVMLCSAR ADVLAAVRDILAELVNTVSDPTSAPPDWPMAAADRLHQQLNGLIEVRANAAMVARRAPRR WGVRSTVRDLDQQAVYLALLVSSVLHLARTIAGPGGDKLPTPVHAVLTDLAAGTGLADAD PTAANEHAAAARATASTLQSAACGSNEVVRADIVQACVTDLQRVIERPGPSGMSA
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structural information about Mb2601c protein?

Mb2601c is a 355-amino acid transmembrane protein from Mycobacterium bovis AF2122/97, classified as a probable transmembrane alanine, valine, and leucine-rich protein . The protein is particularly noteworthy for its transmembrane domains which suggest membrane localization. The full amino acid sequence is: MSASLLVRTACGGRAVAQRLRTVLWPITQTSVVAGLAWYLTHDVFNHPQAFFAPISAVVCMSATNVLRARRAQQMIVGVALGIVLGAGVHALLGSGPIAMGVVVFIALSVAVLCARGLVAQGLMFINQAAVSAVLVLVFASNGSVVFERLFDALVGGGLAIVFSILLFPPDPVVMLCSARADVLAAVRDILAELVNTVSDPTSAPPDWPMAAADRLHQQLNGLIEVRANAAMVARRAPRRWGVRSTVRDLDQQAVYLALLVSSVLHLARTIAGPGGDKLPTPVHAVLTDLAAGTGLADADPTAANEHAAAARATASTLQSAACGSNEVVRADIVQACVTDLQRVIERPGPSGMSA . Researchers should note that the protein has significant sequence similarity to other bacterial integral membrane proteins, including those from Corynebacterium glutamicum (29.4% identity in 255 aa overlap) and Streptomyces coelicolor (26.05% identity in 303 aa overlap) .

How is Mb2601c related to other mycobacterial proteins?

Mb2601c is 100% identical to Rv2571c from Mycobacterium tuberculosis strain H37Rv across all 355 amino acids . This complete identity suggests functional conservation between these species and may indicate important biological roles. When designing experiments targeting Mb2601c, researchers should consider this homology as it allows for translational research between M. bovis and M. tuberculosis models. The protein belongs to the functional category of "Cell wall and cell processes," suggesting its involvement in cell envelope maintenance or biogenesis . Comparative genomic approaches can leverage this relationship to investigate conserved functions across mycobacterial species.

What expression systems are available for recombinant Mb2601c production?

Recombinant Mb2601c can be successfully expressed using in vitro E. coli expression systems . The most common approach involves cloning the full-length protein (amino acids 1-355) with an N-terminal 10xHis-tag for purification purposes . Researchers should consider the following methodological aspects when expressing Mb2601c:

  • Vector selection: pET-based expression systems have proven effective for transmembrane mycobacterial proteins

  • Expression conditions: Induction at lower temperatures (16-20°C) can improve proper folding

  • Solubilization: As a transmembrane protein, detergent screening is crucial for maintaining native conformation

  • Purification: Immobilized metal affinity chromatography utilizing the His-tag, followed by size exclusion chromatography

The recombinant protein can be obtained in either liquid form or as a lyophilized powder, with the latter offering extended shelf stability (approximately 12 months at -20°C/-80°C compared to 6 months for liquid preparations) .

What are the recommended protocols for Mb2601c functional characterization?

Given Mb2601c's uncharacterized status and transmembrane nature, a multi-faceted approach to functional characterization is recommended:

  • Localization studies: Immunofluorescence microscopy using antibodies against the His-tag or the protein itself to confirm membrane localization.

  • Protein-protein interaction analysis: Pull-down assays using the His-tagged recombinant protein, followed by mass spectrometry to identify binding partners.

  • Deletion/knockdown phenotyping: CRISPR/Cas9 or antisense RNA approaches to evaluate physiological effects of protein loss.

  • Transcriptomic analysis: RNA-Seq to identify genes co-regulated with Mb2601c under various conditions.

  • Structural analysis: Circular dichroism to assess secondary structure content, particularly focusing on transmembrane domains.

For researchers interested in detailed characterization, computational prediction tools can also provide initial insights into potential functions. Transmembrane topology prediction suggests multiple transmembrane domains consistent with its annotation as a probable transmembrane protein .

How can I design experiments to determine the role of Mb2601c in mycobacterial cell wall processes?

Since Mb2601c is categorized under "Cell wall and cell processes," experiments should focus on this biological context . A comprehensive experimental design would include:

  • Cell wall integrity assays: Examine susceptibility to cell wall-targeting antibiotics in strains with modified Mb2601c expression.

  • Lipid composition analysis: Compare mycolic acid and other cell wall lipid profiles between wild-type and Mb2601c-deficient strains using thin-layer chromatography and mass spectrometry.

  • Electron microscopy: Evaluate cell envelope ultrastructure in Mb2601c mutants.

  • Cell surface protein analysis: Perform proteomics on cell wall fractions to identify proteins whose localization depends on Mb2601c.

  • Growth assays: Test growth under different stress conditions that affect cell wall integrity (detergents, osmotic stress).

Additionally, researchers should consider leveraging the SSGCN (Siamese spectral-based graph convolutional network) model approach for inferring protein function through transcriptional data analysis, which could provide insights into the regulatory networks involving Mb2601c .

What are the best approaches to study protein-protein interactions involving Mb2601c?

Given the transmembrane nature of Mb2601c, specialized approaches for membrane protein interaction studies are necessary:

  • Bacterial two-hybrid systems: Modified to accommodate membrane proteins, such as BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system.

  • Crosslinking mass spectrometry: Using membrane-permeable crosslinkers followed by mass spectrometry to identify proximal proteins.

  • Co-immunoprecipitation: Using mild detergents to maintain native interactions during purification.

  • Bimolecular Fluorescence Complementation (BiFC): For in vivo validation of specific interactions.

  • Surface Plasmon Resonance (SPR): For quantitative assessment of binding kinetics using purified recombinant protein.

Each of these methods has specific advantages and limitations when applied to transmembrane proteins. Researchers should consider pilot studies with known membrane protein interactions to optimize conditions before investigating Mb2601c interactions .

How can computational approaches complement experimental studies of Mb2601c?

Computational approaches offer valuable insights into Mb2601c's potential function:

  • Structural prediction: While experimental structures are unavailable, AlphaFold or RoseTTAFold can predict the 3D structure based on the amino acid sequence.

  • Molecular dynamics simulations: To study potential conformational changes within membrane environments.

  • Ligand binding site prediction: Tools like FTSite can identify potential binding pockets for small molecules.

  • Comparative genomics: Analysis of gene neighborhood and conservation patterns across mycobacterial species.

  • Machine learning approaches: Similar to the SSGCN model described for drug target inference, machine learning can predict function based on sequence features and transcriptional responses .

These computational predictions should be used to generate testable hypotheses that guide experimental design. For example, predicted binding sites can inform mutagenesis studies to validate functional domains.

What are the challenges in crystallizing transmembrane proteins like Mb2601c?

Crystallizing transmembrane proteins presents unique challenges:

  • Detergent selection: Screening multiple detergents is crucial as they must maintain protein stability while allowing crystal contacts.

  • Construct optimization: Creating truncated constructs that remove flexible regions can improve crystallization propensity.

  • Lipidic cubic phase (LCP) crystallization: This method provides a more native-like environment for membrane proteins.

  • Antibody-mediated crystallization: Co-crystallization with antibody fragments can provide additional crystal contacts.

  • Fusion protein approaches: Inserting a well-crystallizing soluble protein (e.g., T4 lysozyme) into a loop region can facilitate crystallization.

Researchers should consider alternative structural biology approaches such as cryo-electron microscopy which has revolutionized membrane protein structural determination in recent years, particularly for proteins that resist crystallization efforts.

How can I design experiments to investigate Mb2601c's role in mycobacterial pathogenesis?

To investigate Mb2601c's potential role in pathogenesis:

  • Macrophage infection models: Compare wild-type and Mb2601c-deficient strains in their ability to survive within macrophages.

  • Animal infection studies: Evaluate virulence in appropriate animal models using knockout or knockdown strains.

  • Host response analysis: Measure host cytokine responses to determine if Mb2601c modulates immune recognition.

  • Transcriptional profiling: Compare gene expression patterns between wild-type and mutant strains during infection.

  • Drug susceptibility testing: Determine if Mb2601c affects susceptibility to antimycobacterial compounds.

These approaches should be complemented with careful controls, including genetic complementation studies to confirm phenotypes are specifically due to Mb2601c alteration .

What are the optimal storage conditions for recombinant Mb2601c?

Proper storage is crucial for maintaining Mb2601c activity:

  • Short-term storage: For liquid preparations, storage at -20°C/-80°C with minimal freeze-thaw cycles is recommended.

  • Long-term storage: Lyophilized powder stored at -20°C/-80°C provides stability for approximately 12 months.

  • Working aliquots: Prepare single-use aliquots to avoid repeated freeze-thaw cycles.

  • Buffer composition: Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been shown to maintain stability .

  • Reconstitution: When using lyophilized protein, gentle reconstitution avoiding excessive agitation helps maintain protein integrity.

Researchers should validate protein activity after storage periods using appropriate functional assays to ensure experimental reproducibility.

How can I troubleshoot poor expression yields of recombinant Mb2601c?

Low expression yields of transmembrane proteins like Mb2601c are common challenges:

  • Codon optimization: Adapt codons to the expression host to improve translation efficiency.

  • Fusion tags: Test different solubility-enhancing tags beyond the His-tag (e.g., SUMO, MBP, GST).

  • Expression strains: Specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein expression.

  • Induction parameters: Optimize temperature, IPTG concentration, and induction duration.

  • Cell lysis conditions: Ensure complete membrane solubilization with appropriate detergents.

Implementation of high-throughput screening approaches can efficiently identify optimal expression conditions by testing multiple parameters simultaneously.

What are the best methods for validating antibodies against Mb2601c?

Antibody validation is critical for reliable results:

  • Western blotting: Compare signal between wild-type and knockout/knockdown strains.

  • Immunoprecipitation followed by mass spectrometry: Confirm specific pulldown of Mb2601c.

  • Peptide competition assays: Pre-incubation with immunizing peptide should abolish specific signal.

  • Recombinant protein controls: Use purified Mb2601c as a positive control.

  • Cross-reactivity testing: Check for signal in related mycobacterial species based on sequence homology.

How can Mb2601c research contribute to tuberculosis drug development?

As a transmembrane protein with 100% identity to its M. tuberculosis homolog Rv2571c, Mb2601c research has potential implications for drug development:

  • Target validation: Determining if Mb2601c is essential for mycobacterial viability or virulence.

  • Structural studies: Identifying potential binding pockets that could be targeted by small molecules.

  • High-throughput screening: Developing assays to screen compound libraries for Mb2601c inhibitors.

  • Structure-activity relationship studies: Optimizing lead compounds that interact with Mb2601c.

  • Combination therapy approaches: Testing Mb2601c inhibitors with existing antibiotics for synergistic effects.

The SSGCN model for drug target inference could be especially valuable in positioning Mb2601c within the broader context of mycobacterial biology and identifying potential drug targets related to its function .

What novel approaches could help elucidate the function of uncharacterized proteins like Mb2601c?

Innovative approaches for functional characterization include:

  • Chemical genetics: Using small molecule libraries to identify compounds that phenocopy genetic disruption.

  • Proximity labeling: BioID or APEX2 fusion proteins to identify proximal proteins in the native environment.

  • Single-cell transcriptomics: Examining expression heterogeneity under various conditions.

  • CRISPRi screens: Systematic identification of genetic interactions through growth phenotypes.

  • Metabolomics: Identifying metabolic changes associated with Mb2601c disruption.

These approaches can be particularly powerful when combined with traditional biochemical and genetic methods to build a comprehensive understanding of protein function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.