Recombinant Uncharacterized protein Mb2606c (Mb2606c)
Description
Molecular Characterization
Sequence and Structure
-
Amino acid sequence:
MPAGVGNASGSVLDMTSVRTVPSAVALVTFAGAALSGVIPAIARADPVGHQVTYTVTTTSDLMANIRYMSADPPSMAAFNADSSKYMITLHTPIAGGQPLVYTATLANPSQWAIVTASGGLRVNPEFHCEIVVDGQVVVSQDGGSGVQCSTRPW(154 residues) -
Domains: No conserved domains identified in public databases.
Production Details
Biological Context
Genomic Annotation
-
Orthologs: Limited homology to uncharacterized proteins in Mycobacterium tuberculosis and other actinobacteria.
Hypothetical Functional Clues
-
Proteins in the same COG (Clusters of Orthologous Groups) category as Mb2606c are often linked to RNA modification or ribosomal assembly (e.g., rRNA methyltransferases, tRNA synthetases) .
-
No direct experimental evidence links Mb2606c to enzymatic activity or pathway involvement .
Production and Quality Control
Optimized Protocols
-
Expression: Induced in E. coli under T7/lac promoter systems, similar to methods for other mycobacterial proteins .
-
Purification: Immobilized metal affinity chromatography (IMAC) for His-tag isolation .
-
Stability: Lyophilized powder stable at -80°C; working aliquots retain integrity for one week at 4°C .
Critical Quality Metrics
-
Endotoxin levels: Not explicitly stated but typically <1 EU/μg for E. coli-derived proteins .
-
Batch consistency: Confirmed via mass spectrometry and N-terminal sequencing in commercial lots .
Research Applications
Documented Uses
-
Antigen production: Used in ELISA and antibody generation due to its immunogenic properties .
-
Structural studies: Potential candidate for X-ray crystallography or cryo-EM due to solubility in Tris/PBS buffers .
Therapeutic Relevance
-
No direct links to vaccine development or drug targeting, though uncharacterized mycobacterial proteins are often screened for host-pathogen interaction studies .
Comparative Analysis with Related Proteins
| Feature | Mb2606c | M. tuberculosis Rv2606c |
|---|---|---|
| Length | 154 aa | 153 aa |
| Sequence identity | 98% | 100% (ortholog) |
| Known function | Uncharacterized | Uncharacterized |
| Commercial availability | Yes (Creative BioMart, MyBioSource) | Limited |
Challenges and Future Directions
-
Functional elucidation: High-throughput mutagenesis or CRISPR interference (CRISPRi) could identify phenotypic changes in M. bovis knockout strains .
-
Interaction mapping: Yeast two-hybrid screens or affinity purification mass spectrometry (AP-MS) may reveal binding partners .
-
Structural resolution: Cryo-EM studies could clarify its role in mycobacterial physiology .
Product Specs
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
