Recombinant Uncharacterized protein Mb2609c (Mb2609c)

Shipped with Ice Packs
In Stock

Description

Introduction to Mb2609c

Mb2609c is an uncharacterized protein isolated from Mycobacterium bovis, a bacterial species known for its pathogenicity . The protein is classified under the UniProt ID P65024 and the gene name BQ2027_MB2609C . As an uncharacterized protein, Mb2609c's precise biological function remains to be fully elucidated, making it an interesting target for further research in the field of mycobacterial proteins. The uncharacterized designation indicates that experimental evidence confirming its biological role is currently limited, highlighting opportunities for novel discoveries in mycobacterial biology.

The recombinant form of this protein, particularly with an N-terminal His-tag, has been produced to facilitate research applications and functional studies . The availability of this recombinant protein allows researchers to investigate its structural properties and potential biological activities through various experimental approaches. Recombinant protein technology enables the production of substantial quantities of purified protein for detailed biochemical and structural analyses.

Molecular Features

The recombinant form of the protein includes an N-terminal His-tag, which may influence certain physicochemical properties while facilitating purification and detection in laboratory settings . The His-tag is a common feature in recombinant proteins, allowing for efficient purification through metal affinity chromatography. This modification enables researchers to isolate the protein with high purity for subsequent structural and functional analyses.

The protein is synthesized as a full-length construct spanning amino acids 1-340, which preserves the complete native sequence and potentially maintains any functional domains present in the wild-type protein . This complete sequence representation is particularly valuable for structural studies and functional characterization, as truncated proteins may lack essential regions for biological activity.

Expression and Purification

The recombinant Mb2609c protein is produced using E. coli expression systems, a common approach for generating recombinant proteins for research purposes . The full-length protein (amino acids 1-340) is fused to an N-terminal His-tag, which facilitates purification using affinity chromatography techniques . Expression in E. coli provides an efficient system for producing substantial quantities of the recombinant protein for research applications.

The purification process typically involves metal affinity chromatography, leveraging the His-tag's affinity for metal ions such as nickel or cobalt. This approach allows for selective isolation of the recombinant protein from the complex mixture of cellular components. The reported purity of greater than 90%, as determined by SDS-PAGE, indicates a high-quality preparation suitable for most research applications .

Current Understanding of Function

The amino acid sequence may contain clues about potential functions, and bioinformatic analyses comparing this sequence to proteins of known function could provide initial hypotheses. Structural studies could also reveal folding patterns characteristic of particular functional classes of proteins, offering additional insights into its potential biological role.

Research Applications

The recombinant Mb2609c protein can serve various research purposes in the field of mycobacterial biology:

  1. Structural Biology Studies: Determination of three-dimensional structure using techniques such as X-ray crystallography, nuclear magnetic resonance (NMR) spectroscopy, or cryo-electron microscopy could provide valuable insights into the protein's function.

  2. Functional Characterization: Biochemical assays to identify potential enzymatic activities or binding partners may help elucidate the protein's biological role. Techniques such as activity-based protein profiling, thermal shift assays, or interaction studies could be particularly informative.

  3. Immunological Research: Investigation of potential immunogenic properties could reveal whether Mb2609c plays a role in host-pathogen interactions or might serve as a diagnostic marker or vaccine component.

  4. Comparative Genomics: Analysis in the context of related proteins from other mycobacterial species might identify conserved features that suggest functional importance across mycobacterial lineages.

These research applications could significantly contribute to the understanding of mycobacterial biology and potentially reveal insights into pathogenic mechanisms. The availability of high-purity recombinant protein facilitates these investigations by providing material for detailed experimental analyses.

Future Research Directions

Given the limited characterization of Mb2609c to date, several promising avenues for future research could be pursued:

  1. Comprehensive structural analysis to determine secondary and tertiary structural elements would provide a foundation for understanding the protein's functional capabilities. Techniques such as circular dichroism spectroscopy could provide initial insights into secondary structure content.

  2. Protein-protein interaction studies to identify binding partners within the mycobacterial cellular environment could reveal functional associations. Approaches such as co-immunoprecipitation, yeast two-hybrid screening, or proximity labeling techniques could be employed for this purpose.

  3. Gene knockout or knockdown studies to assess the impact on bacterial viability or virulence would provide evidence regarding the protein's importance in mycobacterial physiology or pathogenesis.

  4. Transcriptomic and proteomic analyses to understand expression patterns under various environmental conditions could provide clues about the contexts in which Mb2609c functions. Differential expression under stress conditions or during infection might be particularly informative.

  5. Comparative studies with homologous proteins from other mycobacterial species could reveal evolutionary patterns and conserved features that suggest functional importance.

These research directions could help elucidate the biological role of Mb2609c and its potential significance in mycobacterial biology and pathogenesis. The availability of recombinant protein facilitates many of these approaches by providing purified material for experimental studies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BQ2027_MB2609C; Uncharacterized protein Mb2609c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
BQ2027_MB2609C
Target Protein Sequence
MRWARQAVAVNGMPVDDGALPGLQRIGLVRSVRAPQFDGITFHEVLCKSALNKVPNAAAL PFRYTVNGYRGCSHACRYCFARPTHEYLDFNPGTDFDTQVVVKTNVAAVLRHELRRPSWR RETVALGTNTDPYQRAEGRYALMPGIIGALAASGTPLSILTKGTLLRRDLPLIAEAAQQV PVSVAVSLAVGDPELHRDVESGTPTPQARLALITAIRAAGLDCHVMVAPVLPQLTDSGEH LDQLLGQIAAAGATGVTVFGLHLRGSTRGWFMCWLARAHPELVSRYRELYRRGPYLPPSY REMLRERVAPLIAKYRLAGDHRPAPPETEAALVPVQATLF
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What defines an uncharacterized protein like Mb2609c?

Uncharacterized proteins (sometimes called hypothetical proteins) are proteins that have been predicted from genomic sequences but whose functions have not yet been experimentally determined or confidently predicted. These proteins are typically listed as "Uncharacterized" in genome databases. Annotation of these proteins is crucial for obtaining new facts about organisms, deciphering gene regulation, functions, and pathways, as well as discovering novel target proteins .

Why is it important to characterize proteins like Mb2609c?

The annotation of uncharacterized proteins is essential for several reasons. First, it helps researchers obtain new facts about the organism containing the protein, especially if it's a pathogen. Second, it aids in deciphering gene regulation, functions, and pathways. Third, it contributes to the discovery of novel target proteins that could be investigated for potential drug development. In some cases, characterization reveals that these proteins are important for cell survival inside the host and can act as effective drug targets .

What initial bioinformatic approaches should be used to study Mb2609c?

An effective initial characterization strategy employs multiple bioinformatic tools:

Analysis TypeTools/ApproachesOutput
Physicochemical parametersProtParam, ProtScaleMolecular weight, pI, stability index
Domain identificationPfam, InterPro, SMARTFunctional domains and motifs
Subcellular localizationPSORT, CELLO, SignalPPredicted cellular location
Structure predictionSwiss-PDB, Phyre23D structure models
Interaction networkSTRING analysisPotential protein interaction partners

The efficacy of these prediction methods can be evaluated using receiver operating characteristics (ROC) analysis, which in similar studies has demonstrated accuracy rates of approximately 83.6% .

What is the recommended workflow for functional annotation of Mb2609c?

Based on successful approaches with other uncharacterized proteins, a comprehensive workflow should include:

  • Initial sequence analysis and homology searches

  • Domain and motif identification

  • Secondary and tertiary structure prediction

  • Function prediction based on structural similarities

  • Validation through experimental approaches (recombinant expression, purification)

  • Functional assays based on predicted function

  • Structural studies to confirm predictions

  • Interaction studies to identify partners

This integrated approach combines computational prediction with experimental validation to assign functions with high confidence .

How can structure prediction improve our understanding of Mb2609c?

Homology-based structural modeling can provide crucial insights even when sequence identity with known proteins is relatively low (14-97%). Templates with the most sequence coverage are used for model building using servers like Swiss-PDB and Phyre2. The resulting models can be assessed using tools like PROCHECK and PDBSum to evaluate structural quality. These models help identify potential active sites, binding pockets, and structural motifs that can suggest function. Moreover, they can guide the design of experiments to test functional hypotheses through site-directed mutagenesis or interaction studies .

What experimental approaches can validate the predicted function of Mb2609c?

Experimental validation typically involves multiple complementary approaches:

Validation ApproachMethodologyExpected Outcome
Recombinant expressionOptimized gene design in suitable hostPurified protein for further studies
Biochemical assaysActivity tests based on predicted functionConfirmation of enzymatic or binding activity
Protein-protein interactionsPull-down assays, Y2H, or co-IPValidation of predicted interaction partners
Structural studiesX-ray crystallography or NMRConfirmation of predicted structural features
Genetic manipulationGene knockout or knockdownPhenotypic effects indicating function

This multi-layered validation approach increases confidence in functional assignments .

What considerations are critical when designing a synthetic gene for Mb2609c expression?

When designing a synthetic gene for optimal heterologous expression of an uncharacterized protein like Mb2609c, researchers should consider both protein yield and protein quality. Key factors include:

  • Codon optimization for the host organism

  • mRNA secondary structure optimization

  • GC content adjustment

  • Removal of rare codons and repetitive sequences

  • Elimination of cryptic splice sites or internal regulatory elements

A multivariate optimization approach that combines these various factors known to influence mRNA translation typically yields better results than optimizing individual parameters separately .

How can we minimize amino acid misincorporation during recombinant expression of Mb2609c?

Amino acid misincorporations are a significant concern in recombinant protein production. Studies have identified up to 71 amino acid misincorporation sites in recombinant proteins that were statistically associated with specific codons and protein secondary structures. To minimize these errors:

  • Use balanced codon optimization rather than simply choosing the most frequent codons

  • Consider the influence of protein secondary structure elements on translation accuracy

  • Optimize the mRNA translation rate to allow proper co-translational folding

  • Apply multivariate optimization methods that account for multiple factors simultaneously

  • Monitor protein accuracy using mass spectrometry to detect and quantify amino acid misincorporations

This focus on expression accuracy, not just yield, is crucial for obtaining functionally reliable protein samples .

What expression systems should be considered for producing Mb2609c?

The choice of expression system should be guided by the predicted properties of Mb2609c:

Expression SystemAdvantagesBest For
E. coliFast growth, high yields, simple geneticsSoluble proteins without complex PTMs
Yeast (S. cerevisiae, P. pastoris)Eukaryotic PTMs, secretion capabilityProteins requiring limited glycosylation
Insect cellsMore complex PTMs, good for membrane proteinsProteins requiring proper folding and PTMs
Mammalian cellsFull range of PTMs, authentic foldingComplex proteins with specific modification requirements

For initial characterization, E. coli is often the first choice due to its simplicity and scalability, but the predicted properties of the protein should guide the final selection .

How can mass spectrometry contribute to Mb2609c characterization?

Mass spectrometry is a powerful tool for both protein identification and quality assessment. For uncharacterized proteins like Mb2609c, it can:

  • Confirm the protein identity and sequence

  • Detect and quantify amino acid misincorporations

  • Identify post-translational modifications

  • Assess protein-protein interactions

  • Evaluate structural features through hydrogen-deuterium exchange or chemical crosslinking

Specifically, MS can detect translation errors and quantify their frequency, allowing researchers to correlate these errors with specific gene variables such as codons and protein secondary structures .

What approaches can determine if Mb2609c is a potential virulence factor?

If Mb2609c comes from a pathogenic organism, determining whether it's a virulence factor would be valuable. This assessment can use:

  • Computational prediction tools like VICMPred and VirulentPred

  • Comparative genomics to identify homologs in related pathogenic and non-pathogenic species

  • Expression analysis during infection to determine if the protein is upregulated

  • Gene knockout studies to assess impact on virulence

  • Host-pathogen interaction studies to identify potential host targets

Proteins predicted as virulent factors by multiple independent programs warrant further investigation as potential drug targets .

What protein-protein interaction studies would help elucidate Mb2609c function?

Understanding the interaction network of Mb2609c can provide significant insights into its function:

Interaction MethodApplicationInformation Gained
STRING database analysisComputational predictionPotential interaction partners based on genomic context
Yeast two-hybridExperimental screeningDirect binary interactions
Pull-down assaysTargeted validationConfirmation of predicted interactions
Co-immunoprecipitationIn vivo validationPhysiologically relevant complexes
Proximity labeling (BioID, APEX)In situ mappingSpatial proximity in cellular context

These interactions can suggest biological pathways and processes that Mb2609c might participate in, significantly contributing to functional annotation .

What statistical methods are appropriate for analyzing Mb2609c characterization data?

The choice of statistical method depends on the specific analysis being performed:

  • For comparing expression levels under different conditions: One-way or two-way ANOVA

  • When controlling for covariates: ANCOVA

  • When analyzing multiple dependent variables simultaneously: MANOVA or MANCOVA

  • For examining relationships between variables: Multiple regression (standard, stepwise, or hierarchical)

  • For identifying underlying dimensions in complex datasets: Factor Analysis

Proper statistical analysis ensures the reliability and reproducibility of findings about Mb2609c .

How can we assess the confidence level of functional predictions for Mb2609c?

Confidence assessment for functional predictions is crucial and can be approached through:

  • Receiver Operating Characteristics (ROC) analysis to evaluate prediction methodology

  • Cross-validation of predictions using multiple independent tools

  • Consistency checks between different prediction approaches

  • Bayesian confidence scoring based on multiple evidence types

  • Experimental validation of key predictions

In similar studies, ROC analysis has yielded average accuracies of approximately 83% across parameters, providing a benchmark for confidence assessment .

What approach should be used when contradictory functional predictions emerge for Mb2609c?

When different prediction methods yield contradictory results, a systematic approach includes:

  • Evaluate the confidence scores and reliability metrics of each prediction

  • Prioritize predictions with experimental support or higher confidence scores

  • Consider the evolutionary conservation of features supporting each prediction

  • Design targeted experiments to test competing hypotheses

  • Use integrative approaches that combine multiple lines of evidence with appropriate weighting

This systematic evaluation helps resolve contradictions and guides subsequent experimental design for validation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.