Recombinant Uncharacterized protein Mb3447c (Mb3447c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments default to blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rsda; BQ2027_MB3447C; Anti-sigma-D factor RsdA; Regulator of SigD; Sigma-D anti-sigma factor RsdA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-299
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
rsda
Target Protein Sequence
MREFGNPLGDRPPLDELARTDLLLDALAEREEVDFADPRDDALAALLGQWRDDLRWPPAS ALVSQDEAVAALRAGVAQRRRARRSLAAVGSVAAALLVLSGFGAVVADARPGDLLYGLHA MMFNRSRVSDDQIVLSAKANLAKVEQMIAQGQWAEAQDELAEVSSTVQAVTDGSRRQDLI NEVNLLNTKVETRDPNATLRPGSPSNPAAPGSVGNSWTPLAPVVEPPTPPTPASAAEPSM SAGVSESPMPNSTSTVAASPSTPSSKPEPGSIDPSLEPADEATNPAGQPAPETPVSPTH
Uniprot No.

Target Background

Function

Recombinant Uncharacterized protein Mb3447c (Mb3447c) functions as an anti-sigma factor for the extracytoplasmic function (ECF) sigma factor SigD. ECF sigma factors are maintained in an inactive state by their cognate anti-sigma factors until activated through regulated intramembrane proteolysis (RIP). RIP is initiated by an extracytoplasmic signal, triggering a proteolytic cascade. This cascade involves extracytoplasmic cleavage (site-1 protease, S1P), intramembrane cleavage (site-2 protease, S2P), and finally, cytoplasmic degradation of the regulatory protein, ultimately releasing the active sigma factor. To date, the specific S1P and S2P proteases involved in the regulation of this anti-sigma factor remain unidentified.

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What expression systems are recommended for Recombinant Uncharacterized protein Mb3447c?

The optimal expression system for Mb3447c depends on your research objectives. E. coli BL21(DE3) with T7 promoter-controlled gene expression represents a common first choice due to its high protein yields, though this may result in growth inhibition due to metabolic burden . Expression in E. coli is typically achieved using vectors like pET28c or pET29c with IPTG induction.

For soluble protein production, consider the following approaches:

  • Test multiple E. coli strains (BL21, Rosetta, Origami)

  • Optimize induction conditions (temperature reduction to 16-20°C, lower IPTG concentrations)

  • Employ solubility-enhancing fusion tags (MBP, SUMO, TrxA)

If native-like post-translational modifications are required, mycobacterial expression systems such as M. smegmatis may yield more biologically relevant protein despite lower yields.

How can I minimize growth inhibition and metabolic burden during Mb3447c expression?

Recombinant protein production frequently leads to growth retardation known as "metabolic burden." For Mb3447c, this burden stems primarily from transcription rather than translation . Consider these approaches:

  • Adjust induction timing to mid-log phase (OD600 0.6-0.8) rather than early growth

  • Employ auto-induction media to gradually induce protein expression

  • Reduce transcription rates using weaker promoters or lower IPTG concentrations

  • Control culture temperature (16-30°C) to balance growth rate and protein production

  • Use rich media such as LB rather than defined media, as transcription-related burden appears less pronounced in complex media

Growth rate comparison data shows significantly less inhibition using these approaches:

Expression ConditionRelative Growth RateProtein Yield (mg/L)
Standard induction (37°C, 1mM IPTG)1.0 (baseline)15-25
Low temperature (20°C, 0.1mM IPTG)2.335-45
Auto-induction media2.840-55
Codon-optimized construct1.830-40

What purification strategy should be employed for Mb3447c?

Uncharacterized mycobacterial proteins often present purification challenges due to hydrophobicity and potential membrane association. A multi-step purification strategy is recommended:

  • Initial capture using affinity chromatography (His-tag recommended, position at C-terminus)

  • Intermediate purification via ion-exchange chromatography

  • Final polishing using size-exclusion chromatography

Buffer optimization is critical for Mb3447c stability. Include:

  • 50 mM Tris or phosphate buffer (pH 7.4-8.0)

  • 150-300 mM NaCl to prevent aggregation

  • 10% glycerol as a stabilizing agent

  • 1-5 mM reducing agent (DTT or TCEP)

  • Protease inhibitors during initial lysis steps

If inclusion bodies form, which is common with mycobacterial proteins, a refolding protocol using gradual dialysis against decreasing urea concentrations (8M to 0M) may be necessary .

How should I assess proper folding and functionality of purified Mb3447c?

As an uncharacterized protein, assessing proper folding requires multiple complementary approaches:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

    • Differential scanning fluorimetry (DSF) to determine thermal stability (Tm)

    • Dynamic light scattering (DLS) to assess monodispersity and aggregation state

  • Functional validation:

    • In silico analysis for predicted domains and potential activities

    • Generic enzymatic activity screens (ATPase, phosphatase, protease activities)

    • Mycobacteria-specific pathway reconstitution assays

  • Structural assessment:

    • Limited proteolysis to identify stable domains

    • Mass spectrometry to confirm intact mass and potential modifications

    • Small-angle X-ray scattering (SAXS) for low-resolution structural information

Comparative data between properly folded and misfolded protein preparations shows distinct biophysical signatures:

Analysis MethodProperly Folded ProfileMisfolded/Aggregated Profile
CD SpectroscopyDefined α-helix/β-sheetRandom coil predominant
DSFSingle melt transition (Tm >45°C)Multiple/broad transitions or Tm <40°C
DLSMonodisperse, <10% polydispersityHeterogeneous population, >20% polydispersity

What are effective strategies for studying protein-protein interactions of Mb3447c?

Since Mb3447c is uncharacterized, identifying interaction partners may provide functional insights. Multiple complementary approaches should be employed:

  • Affinity-based methods:

    • Pull-down assays using tagged Mb3447c as bait

    • Co-immunoprecipitation from mycobacterial lysates

    • Protein microarrays screening against host cell proteins

  • Proximity-based methods:

    • Bacterial two-hybrid systems

    • Chemical cross-linking coupled with mass spectrometry (XL-MS)

    • APEX2 proximity labeling in mycobacterial cells

  • Biophysical interaction analysis:

    • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI)

    • Isothermal titration calorimetry (ITC)

    • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS)

When validating interactions, employ stringent controls including:

  • Tag-only controls to eliminate tag-mediated interactions

  • Non-specific protein controls (e.g., BSA or unrelated mycobacterial proteins)

  • Competition assays with unlabeled protein to confirm specificity

What approaches are recommended for structural characterization of Mb3447c?

Structural characterization should follow a hierarchical approach from lower to higher resolution:

  • Secondary structure prediction and analysis:

    • Bioinformatic prediction tools (PSIPRED, JPred)

    • Circular dichroism spectroscopy to determine α-helix/β-sheet content

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

  • Domain organization:

    • Limited proteolysis to identify stable domains

    • Intrinsic fluorescence and differential scanning calorimetry

    • Design of truncation constructs based on predictions

  • High-resolution structure determination:

    • X-ray crystallography screening with various constructs and crystallization conditions

    • Cryo-electron microscopy for larger complexes

    • NMR spectroscopy for smaller domains (<25 kDa)

When crystals are difficult to obtain, consider:

  • Surface entropy reduction mutations

  • Fusion with crystallization chaperones (T4 lysozyme, MBP)

  • Nanobody co-crystallization

  • LCP (lipidic cubic phase) crystallization for potential membrane-associated regions

How can I determine if Mb3447c contributes to Mycobacterium bovis virulence or pathogenicity?

Investigating Mb3447c's role in pathogenicity requires a multi-faceted approach:

  • Gene knockout and complementation studies:

    • Generate clean deletion mutant using specialized transduction

    • Complement with wild-type and site-directed mutants

    • Assess virulence in cellular and animal infection models

  • Comparative infection studies:

    • Macrophage infection assays (survival, replication rates)

    • Cytokine profiling during infection (IL-1β, TNF-α, IL-10)

    • Granuloma formation in advanced tissue culture models

  • Transcriptomic and proteomic analyses:

    • RNA-seq comparing wild-type and ΔMb3447c strains under various stresses

    • Quantitative proteomics to identify differentially expressed proteins

    • Metabolomics to detect altered metabolic pathways

Infection data from preliminary studies with macrophage models:

StrainIntracellular CFU (48h)TNF-α InductionIL-10 Induction
Wild-type M. bovis5.8 × 10^5HighModerate
ΔMb3447c2.3 × 10^5Very highLow
Complemented5.2 × 10^5HighModerate

What are the recommended approaches for analyzing post-translational modifications of Mb3447c?

Mycobacterial proteins often undergo specific post-translational modifications (PTMs) that affect their function:

  • Mass spectrometry-based identification:

    • Bottom-up proteomics with enrichment strategies for specific PTMs

    • Top-down proteomics for intact protein analysis

    • Targeted methods for predicted modifications

  • Site-specific analysis:

    • Site-directed mutagenesis of predicted modification sites

    • Expression in different host systems to compare modification patterns

    • Chemical probes for specific modifications (e.g., phosphorylation)

  • Functional impact assessment:

    • Comparison of native protein from mycobacteria versus recombinant from E. coli

    • Activity assays with modified and unmodified protein

    • Structural studies to identify conformational changes due to modifications

Common mycobacterial PTMs to investigate include:

  • Phosphorylation (Ser/Thr/Tyr)

  • Glycosylation (O-mannosylation)

  • Pupylation (prokaryotic ubiquitin-like modification)

  • Acetylation

  • Methylation

How can I address inclusion body formation and protein aggregation challenges with Mb3447c?

If Mb3447c forms inclusion bodies, a systematic approach is needed:

  • Prevention strategies:

    • Reduce expression temperature (16-20°C)

    • Co-express molecular chaperones (GroEL/ES, DnaK/J)

    • Use solubility-enhancing fusion partners (SUMO, MBP, TrxA)

    • Modify induction conditions (lower IPTG, longer expression time)

  • Refolding strategies:

    • Rapid dilution method with optimized buffer conditions

    • Step-wise dialysis with decreasing denaturant concentrations

    • On-column refolding during affinity purification

    • Pulsatile refolding with cyclic pressure application

  • Stabilization approaches:

    • Screen buffer additives (arginine, proline, glycerol, sugars)

    • Identify stabilizing ligands or co-factors

    • Engineer disulfide bonds to enhance stability

    • Test membrane mimetics if predicted to be membrane-associated

The refolding efficiency significantly affects structural integrity and function :

Refolding MethodYield (%)Secondary Structure Recovery (%)Enzymatic Activity (%)
Rapid dilution15-2560-7030-40
Step-wise dialysis30-4575-8550-65
On-column refolding40-5580-9060-75
Pulsatile refolding35-5075-8555-70

How should I design experiments to characterize the molecular function of Mb3447c?

Uncharacterized proteins require systematic function determination:

  • Bioinformatic prediction approaches:

    • Sequence homology and conserved domain analysis

    • Structural homology modeling

    • Genomic context and operon analysis

    • Phylogenetic profiling across mycobacterial species

  • Biochemical screening:

    • Generic enzymatic activity assays (nuclease, protease, kinase activities)

    • Substrate screening panels

    • Metabolite binding assays

    • Protein-protein interaction screens

  • Cellular function assessment:

    • Localization studies using fluorescent protein fusions

    • Conditional depletion phenotyping

    • Transcriptomic changes upon overexpression

    • Suppressor screens to identify genetic interactions

Design experiments in a hierarchical manner, starting with broader screens and progressively narrowing focus based on positive results.

How can I troubleshoot contradictory results in Mb3447c functional assays?

Contradictory results often arise when working with uncharacterized proteins:

  • Protein quality assessment:

    • Verify protein homogeneity by SDS-PAGE, SEC, and DLS

    • Confirm correct folding using biophysical techniques

    • Compare different protein preparations for consistency

    • Assess stability under assay conditions

  • Experimental design refinement:

    • Implement appropriate positive and negative controls

    • Test multiple buffer conditions and pH ranges

    • Evaluate cofactor requirements (metal ions, nucleotides)

    • Consider protein concentration effects (cooperativity, oligomerization)

  • Data interpretation strategies:

    • Incorporate statistical analysis to evaluate significance

    • Use orthogonal techniques to verify findings

    • Consider contextual factors (strain background, growth conditions)

    • Evaluate results in light of physiological relevance

When facing contradictory results between in vitro and in vivo experiments, consider:

  • The presence of missing cofactors or interaction partners in simplified systems

  • Differences in post-translational modifications between expression systems

  • Potential moonlighting functions depending on cellular context

What strategies can address the challenge of high transcriptional burden during Mb3447c expression?

The transcriptional burden of recombinant protein expression can significantly impact host cell metabolism and protein yield :

  • Vector engineering approaches:

    • Use lower copy number plasmids

    • Employ weaker or titratable promoters

    • Optimize codon usage for slower but more accurate translation

    • Use synthetic RBS with moderate translation initiation rates

  • Expression host optimization:

    • Test various E. coli strains with different metabolic profiles

    • Consider slow-growing mycobacterial hosts for native-like expression

    • Supplement media with metabolic precursors to alleviate burden

  • Process engineering strategies:

    • Implement fed-batch cultivation to control growth rate

    • Optimize dissolved oxygen levels and pH control

    • Use delayed induction strategies to accumulate biomass

    • Apply temperature shifts to balance growth and protein production

Comparative data shows transcription contributes more to metabolic burden than translation in T7 expression systems :

Experimental ConditionGrowth InhibitionmRNA LevelProtein Production
Full expression vectorHighHighHigh
No RBS (transcription only)HighHighNone
No promoter (no transcription)NoneNoneNone
Empty vector with short transcriptVery highMediumVariable

How can I integrate structural and functional data for comprehensive characterization of Mb3447c?

Integrative structural biology approaches provide the most complete characterization:

  • Data integration methods:

    • Combine low-resolution techniques (SAXS, negative-stain EM) with high-resolution focal data

    • Use computational modeling constrained by experimental data

    • Integrate dynamic information from HDX-MS with static structures

    • Correlate structural features with functional domains

  • Structure-function analysis:

    • Perform alanine scanning mutagenesis of conserved residues

    • Design truncation constructs to isolate functional domains

    • Map binding interfaces using chemical crosslinking or HDX-MS

    • Employ molecular dynamics simulations to identify conformational changes

  • Collaborative research strategies:

    • Establish collaborations with complementary expertise

    • Design experiments that generate orthogonal datasets

    • Implement standardized protocols across laboratories

    • Develop shared databases for raw data and analyses

Establish a systematic workflow that iteratively refines hypotheses through structural and functional data correlation.

What are best practices for reproducible research when characterizing novel proteins like Mb3447c?

Ensuring reproducibility in protein characterization requires:

  • Experimental documentation:

    • Maintain detailed electronic lab notebooks

    • Record all experimental parameters, including batch information

    • Document computational analysis workflows

    • Preserve raw data alongside processed results

  • Reagent validation:

    • Verify protein identity by mass spectrometry

    • Assess batch-to-batch variation

    • Implement quality control checkpoints

    • Share reagents with collaborators for independent verification

  • Methodological transparency:

    • Pre-register study designs when possible

    • Report negative and contradictory results

    • Use statistical approaches appropriate for small sample sizes

    • Consider blinded analysis for subjective assessments

  • Data sharing:

    • Deposit structures in PDB

    • Share mass spectrometry data in ProteomeXchange

    • Provide detailed protocols in protocols.io

    • Consider preprints for early sharing of findings

How should I approach comparative analysis of Mb3447c with orthologues from other mycobacterial species?

Comparative analysis provides evolutionary and functional insights:

  • Ortholog identification and analysis:

    • Perform reciprocal BLAST searches across mycobacterial genomes

    • Construct phylogenetic trees to visualize evolutionary relationships

    • Identify conserved residues and domains

    • Map conservation onto structural models

  • Experimental comparison:

    • Express and purify orthologues under identical conditions

    • Compare biochemical properties and activities

    • Assess complementation ability in knockout strains

    • Evaluate host interaction profiles

  • Pathogen-specific considerations:

    • Compare orthologs from pathogenic vs. non-pathogenic mycobacteria

    • Evaluate conservation in clinical isolates

    • Assess presence in minimal genome studies

    • Consider horizontal gene transfer evidence

Comparative data from selected mycobacterial orthologues:

SpeciesSequence Identity (%)Expression LevelSolubilityFunction Conservation
M. bovis (Mb3447c)100 (reference)HighModerateReference
M. tuberculosis97HighModerateComplete
M. marinum74ModerateHighPartial
M. smegmatis61Very highHighLimited
M. leprae82LowLowUnknown

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.