Recombinant Uncharacterized protein Mb3818 (Mb3818)

What is Recombinant Uncharacterized protein Mb3818?

Recombinant Uncharacterized protein Mb3818 is a full-length protein (121 amino acids) derived from Mycobacterium bovis. It is also annotated as "Arabinogalactan biosynthesis recruiting protein Mb3818" and has the UniProt ID P64293. The protein is classified as uncharacterized because its precise biological function has not been fully elucidated through experimental validation, despite some functional predictions based on sequence analysis .

What is the amino acid sequence of Mb3818?

The full amino acid sequence of Mb3818 is: MRFVVTGGLAGIVDFGLYVVLYKVAGLQVDLSKAISFIVGTITAYLINRRWTFQAEPSTARFVAVMLLYGITFAVQVGLNHLCLALLHYRAWAIPVAFVIAQGTATVINFIVQRAVIFRIR. This 121-amino acid sequence serves as the foundation for structural and functional predictions, and understanding this primary structure is essential for designing experiments to elucidate the protein's function .

How is recombinant Mb3818 typically produced?

Recombinant Mb3818 is commonly expressed in E. coli expression systems with an N-terminal His-tag for purification purposes. The His-tagged recombinant protein includes the full-length sequence (amino acids 1-121) and is produced through standard recombinant protein expression techniques optimized for bacterial expression. This approach facilitates protein purification through affinity chromatography and yields protein with greater than 90% purity as determined by SDS-PAGE .

What expression systems are optimal for Mb3818 production?

While E. coli is the most commonly documented expression system for Mb3818, alternative expression hosts can be considered depending on experimental requirements. E. coli offers advantages of high yield and shorter production times, making it suitable for initial characterization studies. For studies requiring post-translational modifications or improved protein folding, insect cells with baculovirus or mammalian expression systems might be more appropriate, though these systems have not been specifically documented for Mb3818 .

What are the optimal storage conditions for purified Mb3818?

Purified recombinant Mb3818 should be stored at -20°C/-80°C upon receipt. For long-term storage, aliquoting is necessary to avoid repeated freeze-thaw cycles, which can compromise protein stability and activity. A recommended approach is to reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add glycerol to a final concentration of 5-50% (with 50% being the default) before aliquoting and storing at -20°C/-80°C. For working stocks, aliquots can be maintained at 4°C for up to one week .

How should Mb3818 be reconstituted for experimental use?

For optimal reconstitution of lyophilized Mb3818:

• Briefly centrifuge the vial to bring contents to the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% for storage stability

• Aliquot to minimize freeze-thaw cycles

The reconstituted protein is stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain protein stability .

What computational methods can predict Mb3818 function?

For uncharacterized proteins like Mb3818, in silico approaches offer valuable preliminary insights into potential functions. A comprehensive computational characterization workflow might include:

• Conserved domain analysis to identify functional motifs

• Homology modeling to predict three-dimensional structure

• Comparative genomics to identify orthologs in related species

• Protein-protein interaction predictions

• Subcellular localization prediction

• Analysis of genomic context and neighboring genes

These approaches mirror those applied to uncharacterized proteins in other bacterial species, such as Clostridium difficile, where computational methods have successfully identified potential functions and structural characteristics .

How can I experimentally investigate potential roles in arabinogalactan biosynthesis?

Given Mb3818's annotation as an "Arabinogalactan biosynthesis recruiting protein," investigating this potential function requires a targeted experimental approach:

• Cell wall component analysis in wild-type vs. Mb3818-knockout Mycobacterium strains

• In vitro arabinogalactan synthesis assays with and without purified Mb3818

• Protein-protein interaction studies (pull-down assays, co-immunoprecipitation) to identify binding partners involved in arabinogalactan synthesis

• Localization studies to determine if Mb3818 colocalizes with cell wall synthesis machinery

• Functional complementation studies in related mycobacterial species

These approaches can systematically probe the specific biochemical and cellular functions of Mb3818 in the context of cell wall biosynthesis .

What expression pattern analysis can reveal Mb3818's physiological relevance?

Understanding when and where Mb3818 is expressed provides critical insights into its biological significance. While no specific expression data for Mb3818 is provided in the search results, a methodology similar to that used for uncharacterized Drosophila proteins can be applied:

• Quantitative PCR to measure expression levels across different growth conditions and stress responses

• RNA-seq analysis to identify co-expressed genes that might function in related pathways

• Reporter gene assays (such as lacZ or GFP fusions) to monitor expression in vivo

• Northern blot analysis to identify transcript size and potential processing

• Promoter analysis to identify regulatory elements controlling Mb3818 expression

These approaches can establish the conditions under which Mb3818 is expressed, potentially revealing its physiological relevance and regulatory networks .

How can genetic knockout studies be designed to investigate Mb3818 function?

A comprehensive genetic analysis of Mb3818 function would incorporate:

• CRISPR-Cas9 or homologous recombination to generate precise gene deletions

• Complementation with wild-type and mutant variants to confirm phenotypes

• Conditional knockout systems (if essential) using inducible promoters

• Phenotypic characterization across multiple growth conditions

• Transcriptomic and proteomic profiling of knockout strains

• Fitness assays in competition with wild-type strains

This genetic approach can establish whether Mb3818 is essential for viability and identify specific growth conditions or stresses where the protein plays a critical role, similar to approaches used for uncharacterized proteins in other bacterial systems .

How can I address poor solubility of recombinant Mb3818?

Poor solubility is a common challenge when working with bacterial membrane-associated proteins. For Mb3818, which may be involved in cell wall processes, solubility can be particularly challenging. Strategies to improve solubility include:

• Optimization of expression temperature (typically lowering to 16-18°C)

• Testing different detergents for protein extraction

• Expressing truncated versions to identify soluble domains

• Using solubility-enhancing fusion tags (MBP, SUMO, etc.) beyond the His-tag

• Adjusting buffer conditions (pH, salt concentration, reducing agents)

• Exploring refolding strategies from inclusion bodies if necessary

Each protein requires empirical optimization, and conditions successful for other mycobacterial proteins might serve as a starting point .

What quality control measures should be implemented for recombinant Mb3818?

Before proceeding with functional studies, thorough quality assessment should include:

• SDS-PAGE and Western blotting to confirm identity and purity (>90% purity standard)

• Mass spectrometry to verify sequence integrity and identify potential modifications

• Size exclusion chromatography to assess oligomerization state

• Circular dichroism to evaluate secondary structure content

• Thermal shift assays to determine stability under various buffer conditions

• Activity-based assays if a preliminary function is predicted

These quality control measures ensure that subsequent functional studies are performed with properly folded, homogeneous protein preparation .

How conserved is Mb3818 across mycobacterial species?

Understanding the evolutionary conservation of Mb3818 can provide insights into its functional importance:

• BLAST analysis to identify homologs across mycobacterial species

• Multiple sequence alignment to identify conserved residues

• Phylogenetic analysis to trace evolutionary relationships

• Synteny analysis to examine conservation of genomic context

• Comparative analysis with related proteins in other bacterial phyla

• Assessment of selection pressure (dN/dS ratios) to identify functionally constrained regions

This evolutionary perspective can highlight residues likely critical for function and suggest experimental targets for mutagenesis studies .

What related proteins might provide functional insights into Mb3818?

A systematic approach to identify proteins that might share functional characteristics with Mb3818 includes:

• Domain-based searches to identify proteins with similar functional modules

• Secondary structure-based comparisons to identify structural analogs

• Analysis of protein-protein interaction networks to identify functional associations

• Examination of co-expression patterns across conditions

• Mining literature for functionally characterized proteins with similar features

This information can be integrated from databases such as UniProt, the Alliance for Genome Resources, and specialized mycobacterial databases to develop testable hypotheses about Mb3818 function .