Recombinant Uncharacterized protein ML0007 (ML0007)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ML0007; MLB1770.07; Uncharacterized protein ML0007
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Mycobacterium leprae (strain TN)
Target Names
ML0007
Target Protein Sequence
MTSPNESRAFNAADDLIGDGSVERAGLHRATSVPGESSEGLQRGHSPEPNDSPPWQRGSA RASQSGYRPSDPLTTTRQSNPAPGANVRSNRFISGMTAPALSGQLPKKNNSTQALEPVLM SNEVPFTESYASELPDLSGPVQRTVPCKPSPDRGSSTPRMGRLEITKVRGTGEIRSQISR RSHGPVRASMQIRRIDPWSMLKVSLLLSVALFFVWMIAVAFLYLLLGGMGVWAKLNSNVG DLLNNTGGNSGELVSNSTIFGCAVLVGLVNIVLMTTMAAIAAFVYNLSSDLVGGVEVTLA DLD
Uniprot No.

Target Background

Database Links

KEGG: mle:ML0007

STRING: 272631.ML0007

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic characterization of ML0007?

ML0007 is an uncharacterized protein from Mycobacterium leprae with a molecular weight of approximately 32,237 Da. The full-length protein consists of 303 amino acids . According to sequence data, it appears to be a probable membrane protein with multiple transmembrane domains. The protein sequence is: "MTSPNESRAF NAADDLIGDG SVERAGLHRA TSVPGESSEG LQRGHSPEPN DSPPWQRGSA RASQSGYRPS DPLTTTRQSN PAPGANVRSN RFISGMTAPA LSGQLPKKNN STQALEPVLM SNEVPFTESY ASELPDLSGP VQRTVPCKPS PDRGSSTPRM GRLEITKVRG TGEIRSQISR RSHGPVRASM QIRRIDPWSM LKVSLLLSVA LFFVWMIAVA FLYLLLGGMG VWAKLNSNVG DLLNNTGGNS GELVSNSTIF GCAVLVGLVN IVLMTTMAAI AAFVYNLSSD LVGGVEVTLA DLD" .

What expression systems are available for recombinant ML0007 production?

Recombinant ML0007 can be expressed in several host systems:

  • E. coli: Offers high yield and shorter turnaround times, suitable for basic structural studies

  • Yeast: Provides some post-translational modifications with relatively good yields

  • Insect cells (baculovirus): Offers more complex post-translational modifications

  • Mammalian cells: Provides the most comprehensive post-translational modifications

For uncharacterized proteins like ML0007, it's recommended to start with E. coli for initial characterization before moving to more complex expression systems if protein activity or proper folding becomes an issue .

What experimental design is most appropriate for studying an uncharacterized protein like ML0007?

When studying an uncharacterized protein like ML0007, a multi-phase experimental design is recommended:

Phase 1: Basic characterization (between-subjects design)

  • Subcellular localization studies (fluorescent tagging, fractionation)

  • Structural analysis (circular dichroism, X-ray crystallography)

  • Basic biochemical assays (stability, solubility)

Phase 2: Functional analysis (mixed design)

  • Protein-protein interaction studies (yeast two-hybrid, pull-down assays)

  • Comparative genomics analysis (bioinformatics)

  • Gene knockout/knockdown studies

Phase 3: Contextual analysis (longitudinal studies)

  • Expression profiling during infection models

  • Response to environmental stressors

  • Functional complementation studies

This phased approach allows for systematic characterization while controlling for experimental variables .

How should I design experiments to investigate potential membrane localization of ML0007?

Based on sequence analysis suggesting ML0007 may be a membrane protein, a comprehensive experimental design should include:

  • Computational prediction validation:

    • Use multiple membrane protein prediction algorithms

    • Identify potential transmembrane domains

  • Biochemical fractionation:

    • Perform membrane vs. cytosolic fractionation

    • Use detergent solubility assays (triton X-114 partitioning)

  • Microscopy-based localization:

    • Fluorescent protein tagging (N-terminal and C-terminal fusions)

    • Immunofluorescence with anti-tag antibodies

    • Co-localization with known membrane markers

  • Protease protection assays:

    • Determine membrane topology

    • Identify exposed domains

For valid results, include both positive controls (known membrane proteins) and negative controls (cytosolic proteins) .

What statistical approaches are appropriate for analyzing ML0007 expression data?

When analyzing ML0007 expression data, particularly from transcriptomic studies, consider the following statistical approaches:

  • For comparing expression across conditions (e.g., reactional vs. non-reactional states):

    • t-tests for pairwise comparisons

    • ANOVA for multiple conditions

    • FDR (False Discovery Rate) correction for multiple testing

  • For correlation with other genes:

    • Pearson or Spearman correlation coefficients

    • Principal Component Analysis (PCA)

    • Hierarchical clustering

  • For time-course experiments:

    • Repeated measures ANOVA

    • Linear mixed models

    • Time series analysis

Data from search results indicate ML0007 (along with genes like ML2388) may show differential expression in reactional states of leprosy, requiring robust statistical approaches to validate findings .

How can I integrate transcriptomic data into functional studies of ML0007?

To effectively integrate transcriptomic data with functional studies of ML0007:

  • Identify co-expressed genes:

    • Analyze RNA-seq or microarray data to find genes with similar expression patterns

    • Use clustering algorithms to group functionally related genes

    • Look for enriched pathways or functional categories

  • Design validation experiments:

    • Select conditions where ML0007 shows significant differential expression

    • Verify expression changes using qRT-PCR

    • Correlate expression with phenotypic changes

  • Perform network analysis:

    • Construct protein-protein interaction networks

    • Identify potential binding partners through co-expression analysis

    • Map ML0007 to biological pathways

  • Follow up with targeted experiments:

    • Design loss/gain of function studies for significant conditions

    • Test protein interactions identified from network analysis

    • Examine phenotypic effects in relevant models

This integrated approach provides a more comprehensive understanding of ML0007's potential function .

How can I determine if ML0007 contains potential epitopes for immunological studies?

For immunological characterization of ML0007:

  • Computational epitope prediction:

    • Use algorithms like Bepipred-2.0 to predict B-cell epitopes

    • Apply T-cell epitope prediction tools (NetMHC, IEDB)

    • Assess epitope conservation across mycobacterial species

  • Peptide synthesis and validation:

    • Synthesize predicted epitope peptides

    • Test binding to MHC molecules (in vitro assays)

    • Validate immunogenicity in animal models

  • Recombinant protein immunization studies:

    • Express and purify recombinant ML0007

    • Immunize animal models

    • Characterize antibody responses (specificity, titer, isotype)

Based on search results, ML2388 (another mycobacterial protein) has been found to contain distinct B-cell epitopes, suggesting similar approaches could be valuable for ML0007 .

What longitudinal experimental designs would be appropriate for studying ML0007's role in Mycobacterium leprae pathogenesis?

A comprehensive longitudinal design for studying ML0007's role in pathogenesis should include:

  • Time-course infection models:

    • In vitro macrophage infection (24h, 48h, 72h, 1 week)

    • Animal models with sampling at multiple timepoints

    • ML0007 expression monitoring throughout infection cycle

  • Statistical design considerations:

    • Power analysis to determine appropriate sample sizes

    • Repeated measures design with appropriate controls

    • Mixed-effects models for data analysis

  • Experimental approach:

    • Compare wild-type vs. ML0007 knockdown/knockout strains

    • Monitor host response changes over time

    • Correlate ML0007 expression with disease progression markers

  • Control strategies:

    • Include both positive controls (known virulence factors)

    • Negative controls (non-pathogenic mycobacteria)

    • Technical replicates for each timepoint

This approach allows for rigorously testing hypotheses about ML0007's temporal role in pathogenesis .

What are the main challenges in working with recombinant ML0007 and how can they be addressed?

Major challenges and their solutions include:

  • Low solubility issues:

    • Optimize expression conditions (temperature, induction)

    • Use solubility tags (SUMO, MBP, GST)

    • Consider refolding protocols from inclusion bodies

    • Try detergent-based extraction for membrane proteins

  • Purification difficulties:

    • Test multiple affinity tags (His, FLAG, Strep)

    • Optimize buffer conditions (pH, salt, detergents)

    • Employ size exclusion chromatography as a final polishing step

    • Consider on-column refolding techniques

  • Stability problems:

    • Screen stabilizing buffer additives (glycerol, sugar alcohols)

    • Determine optimal storage conditions (-80°C, lyophilization)

    • Add protease inhibitors to prevent degradation

    • Consider flash-freezing in liquid nitrogen

  • Activity assessment:

    • Develop functional assays based on bioinformatic predictions

    • Use thermal shift assays to monitor proper folding

    • Employ circular dichroism to assess secondary structure

    • Test interaction with predicted binding partners

These methodological approaches help overcome common challenges with uncharacterized recombinant proteins .

How can I design experiments to investigate potential functions of ML0007 based on limited information?

When investigating an uncharacterized protein like ML0007 with limited information:

  • Leverage bioinformatic predictions:

    • Structural homology modeling

    • Domain function prediction

    • Subcellular localization prediction

    • Protein family classification

  • Design hypothesis-driven experiments:

    • Test predicted enzymatic activities

    • Assess interaction with predicted binding partners

    • Evaluate role in predicted cellular processes

  • Employ unbiased screening approaches:

    • Yeast two-hybrid library screening

    • Pull-down assays coupled with mass spectrometry

    • Phenotypic screening of knockdown/knockout strains

    • Transcriptional profiling under various conditions

  • Use comparative genomics:

    • Study homologs in related species

    • Examine genomic context for functional clues

    • Analyze conservation patterns across mycobacterial species

This systematic approach maximizes the chance of functional discovery while minimizing resource expenditure on unpromising avenues .

How should I integrate multiple datasets when studying ML0007?

For comprehensive characterization of ML0007, integrate diverse datasets as follows:

  • Data types to consider:

    • Transcriptomic data (RNA-seq, microarray)

    • Proteomic data (mass spectrometry)

    • Structural data (crystallography, NMR)

    • Functional assays (enzymatic, binding)

    • Phenotypic data (knockout studies)

  • Integration methods:

    • Use computational frameworks for multi-omics integration

    • Apply network analysis to identify connections between datasets

    • Develop predictive models combining multiple data types

    • Validate key findings across multiple platforms

  • Visualization strategies:

    • Create integrated heatmaps showing patterns across datasets

    • Develop network visualizations of protein interactions

    • Design pathway maps incorporating multiple data types

    • Use dimensionality reduction to visualize complex relationships

  • Statistical considerations:

    • Apply appropriate normalization for cross-platform comparison

    • Use integrative statistical methods (MOFA, DIABLO)

    • Perform meta-analysis across independent experiments

    • Implement rigorous validation procedures

This approach provides a more complete understanding of ML0007's biological context .

What are the best practices for publishing research on uncharacterized proteins like ML0007?

When publishing research on uncharacterized proteins like ML0007:

  • Structure your manuscript effectively:

    • Clearly state the significance of studying this uncharacterized protein

    • Present bioinformatic predictions as a foundation

    • Describe experimental validation methodologies in detail

    • Present findings hierarchically, from basic characterization to functional insights

  • Address methodological considerations:

    • Provide detailed protocols for recombinant protein production

    • Include all quality control measures (purity, activity)

    • Describe statistical approaches comprehensively

    • Explain rationale for experimental design choices

  • Data presentation guidelines:

    • Include comprehensive supplementary data

    • Present negative results alongside positive findings

    • Use appropriate visualization for complex datasets

    • Provide access to raw data through repositories

  • Contextual framing:

    • Relate findings to broader biological processes

    • Discuss implications for mycobacterial research

    • Acknowledge limitations and propose future directions

    • Suggest potential applications (e.g., diagnostic, therapeutic)

Following these practices enhances the impact and reproducibility of research on uncharacterized proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.