Recombinant Uncharacterized protein ML0869 (ML0869)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and approved in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and storing in aliquots at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
ML0869; MLCB22.07; Uncharacterized protein ML0869
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Mycobacterium leprae (strain TN)
Target Names
ML0869
Target Protein Sequence
MKLLGRKKSYGQDIETSDDNVGSEASLPDTLSRGSSTTAPKGRPTRKRDDADRRHTKKGP ITPAPMTASEARARRKSLAPPKCHRAERRAKRAASKAQITDRRERMMAGEEAYLPPRDQG PVRRYIRDLVDARRNALGLFTPSALVLLFITFGVPQLQLYMSPAMLVLLSVMGIDGIILG RKISKLVDVKFPSNTESHWRLGLYAAGRASQMRRLRVPRPQVEHGSSVG
Uniprot No.

Target Background

Database Links

STRING: 272631.ML0869

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ML0869 and why is it relevant for research?

ML0869 is an uncharacterized protein from Mycobacterium leprae (strain TN) with Uniprot accession number Q9CCF6. It represents one of many proteins in bacterial genomes listed as "uncharacterized" due to lack of better sequence homologs or structurally related proteins. Researching such proteins is crucial for obtaining new facts about pathogens, deciphering gene regulation, functions, and pathways, along with discovering novel target proteins for therapeutic interventions. Functional annotation of uncharacterized proteins has shown that some of these proteins are important for cell survival inside the host and can act as effective drug targets . Research on ML0869 contributes to broader efforts in understanding M. leprae pathophysiology and potential virulence factors.

What computational approaches can be used to predict ML0869 function?

The function of ML0869 can be predicted using a multifaceted bioinformatics approach:

  • Physicochemical parameter prediction: Tools for analyzing amino acid composition, molecular weight, theoretical pI, instability index, and grand average of hydropathicity (GRAVY).

  • Domain and motif search: Software like InterProScan, SMART, and Pfam for identifying functional domains.

  • Pattern search: Tools like PRINTS, PROSITE for sequence patterns associated with specific functions.

  • Subcellular localization prediction: PSORT, CELLO, and TargetP for predicting where the protein functions within the cell.

  • String analysis: To reveal potential interacting partners which may suggest functional associations.

  • Homology-based structure prediction: Using Swiss PDB and Phyre2 servers for structural modeling .

This computational workflow has demonstrated approximately 83.6% efficacy in uncharacterized protein function prediction based on receiver operating characteristics (ROC) analysis . By utilizing these tools, researchers can assign potential roles to ML0869 such as enzymatic activity, transport functions, or involvement in cellular processes.

What expression systems are optimal for producing recombinant ML0869?

For recombinant ML0869 production, researchers have several expression system options, each with distinct advantages:

E. coli Expression System:

  • Advantages: Rapid growth at high cell density, relatively inexpensive substrates, well-established genetic background

  • Considerations: Ensure proper codon optimization for M. leprae genes in E. coli

  • Recommended strains: BL21(DE3) or derivatives that suppress basal expression for potentially toxic proteins

Yeast Expression System:

  • Advantages: Post-translational modifications closer to mammalian systems, potential for higher solubility

  • Considerations: Longer expression times compared to E. coli

  • Best for: If transmembrane regions cause insolubility issues in bacterial systems

The choice of expression system should be guided by experimental goals. For structural studies requiring high yields, E. coli systems typically produce 250 mg/L of soluble protein under optimized conditions . For functional studies where proper folding is critical, yeast expression may be preferable despite potentially lower yields.

How can statistical experimental design optimize ML0869 expression?

Statistical experimental design methodologies can significantly enhance ML0869 expression by systematically evaluating multiple variables simultaneously. The multivariant approach allows for:

  • Variables identification: Crucial factors affecting ML0869 expression include:

    • Temperature (typically 18-37°C)

    • Inducer concentration

    • Cell density at induction

    • Media composition

    • Duration of induction

    • pH

    • Oxygen transfer rate

    • Co-expression of chaperones

  • Fractional factorial screening design: Using a 2^(8-4) design with two levels for each of eight variables and replicas at the central point offers statistical power while minimizing experiment numbers .

  • Response measurement: Key metrics include:

    • Cell growth

    • Biological activity of the expressed protein

    • Productivity (mg protein per L culture)

This approach has demonstrated success in optimizing recombinant protein expression, achieving up to 250 mg/L of soluble, functional protein with 75% homogeneity . The experimental design not only maximizes yield but also identifies interaction effects between variables that would be missed in one-variable-at-a-time approaches .

What purification strategies yield highest purity ML0869 for structural studies?

A multi-step purification strategy is recommended for obtaining high-purity ML0869 suitable for structural studies:

Step 1: Initial Capture

  • Immobilized metal affinity chromatography (IMAC) for His-tagged ML0869

  • Ion exchange chromatography (particularly Nuvia Q anion-exchange resin) for untagged protein15

Step 2: Intermediate Purification

  • Size exclusion chromatography to separate monomeric from aggregated forms

  • Removal of tag via protease cleavage if necessary

Step 3: Polishing

  • Hydrophobic interaction chromatography (HIC) using Macro-Prep Methyl resin15

  • High-resolution ion exchange chromatography

This workflow typically yields >98% pure protein as assessed by analytical methods. For transmembrane proteins like ML0869, incorporating detergents or amphipathic agents during purification is critical for maintaining native structure and preventing aggregation. Optimization of buffer conditions including salt concentration, pH, and additives like glycerol (typically at 5-50% final concentration) can significantly improve stability during purification and storage .

How can protein-protein interaction studies illuminate ML0869 function?

Protein-protein interaction (PPI) studies are powerful for uncovering the functional role of uncharacterized proteins like ML0869. A comprehensive approach includes:

In silico methods:

  • String analysis to predict interaction networks based on genomic context, co-expression, and literature

  • Structural docking to predict physical interactions based on protein models

Experimental validation:

  • Yeast two-hybrid screening against M. leprae proteome

  • Co-immunoprecipitation coupled with mass spectrometry

  • Biolayer interferometry to measure binding kinetics

  • Crosslinking mass spectrometry to capture transient interactions

By constructing an interaction network, researchers can infer ML0869 function through guilt-by-association principles. For example, if ML0869 interacts predominantly with proteins involved in cell wall maintenance, it likely functions in related processes. Similar approaches with other uncharacterized proteins have successfully identified functional roles and potential virulence factors . The interactome data should be validated through multiple orthogonal techniques to minimize false positives inherent to any single PPI detection method.

What biochemical assays can determine if ML0869 has enzymatic activity?

To determine if ML0869 possesses enzymatic activity, researchers should employ a systematic approach guided by computational predictions:

  • Initial screening based on sequence homology and structural predictions:

    • Identify potential catalytic motifs and active site residues

    • Compare with known enzyme families

  • General activity assays:

    • Hydrolase activity using fluorogenic substrates

    • Transferase activity with labeled donor molecules

    • Oxidoreductase activity through NAD(P)H consumption/production

    • Ligase or lyase activity through appropriate substrate conversion

  • Targeted assays based on predicted function:

    • If predictions suggest involvement in specific pathways (e.g., arginine metabolism like Q8RGP8), test with pathway-specific substrates

    • For transmembrane proteins, consider transport assays using liposomes or proteoliposomes

  • Site-directed mutagenesis of predicted catalytic residues to confirm their importance for any detected activity

Successful functional annotation of uncharacterized proteins from M. leprae and related organisms has revealed enzymes like nucleoside phosphorylase, DNA helicase, and permuted papain-like amidase . For enzymatic characterization, purified recombinant ML0869 should be tested under various conditions (pH, temperature, cofactors) to determine optimal activity parameters.

How can advanced imaging techniques contribute to understanding ML0869 localization and function?

Advanced imaging techniques offer valuable insights into ML0869's subcellular localization, dynamics, and potential functional roles:

Fluorescence microscopy approaches:

  • Fusion with fluorescent proteins (GFP, mCherry) to track localization in live cells

  • Super-resolution microscopy (STORM, PALM) to visualize distribution with nanometer precision

  • FRET analysis to detect protein-protein interactions in situ

Electron microscopy techniques:

  • Immunogold labeling for precise subcellular localization

  • Cryo-electron microscopy for structural determination within cellular context

  • Electron tomography to visualize membrane integration of transmembrane domains

Correlative light and electron microscopy (CLEM):

  • Combines advantages of both techniques for comprehensive analysis

These methods must be adapted for mycobacterial systems, considering their unique cell wall architecture. For transmembrane proteins like ML0869, determining cellular distribution patterns (polar, diffuse, or specific membrane domains) can provide functional clues. Colocalization studies with proteins of known function can further suggest participation in specific cellular processes . Temporal studies during infection models may reveal whether ML0869 relocalization occurs under different conditions, potentially indicating involvement in pathogenesis.

What approaches can determine if ML0869 contributes to M. leprae virulence?

Determining ML0869's potential contribution to M. leprae virulence requires multiple complementary approaches:

Comparative genomics:

  • Analyze conservation across mycobacterial species, particularly pathogenic vs. non-pathogenic strains

  • Evaluate presence of homologs in other intracellular pathogens

Gene expression analysis:

  • Examine ML0869 expression levels during different infection stages

  • Compare expression under various stress conditions mimicking host environments

Heterologous expression systems:

  • Express ML0869 in non-pathogenic mycobacteria to assess gain-of-function

  • Express in model organisms like M. smegmatis to examine effects on host cell interactions

Infection models:

  • Use armadillo or mouse footpad models (standard for leprosy research)

  • Analyze ML0869 antibody responses in patient sera as indicator of in vivo expression

Two probable virulent factors were identified in related uncharacterized protein studies that could serve as effective drug targets . If ML0869 demonstrates characteristics similar to known virulence factors—such as involvement in host cell invasion, immune evasion, or survival under stress conditions—it would warrant further investigation as a potential therapeutic target.

How can structural biology techniques elucidate ML0869 function?

Structural biology offers powerful approaches to understand ML0869 function at the molecular level:

X-ray crystallography:

  • Requires production of diffraction-quality crystals, challenging for membrane proteins

  • May require detergent screening or lipidic cubic phase crystallization

  • Can provide atomic-level resolution of protein structure

Nuclear Magnetic Resonance (NMR) spectroscopy:

  • Suitable for smaller domains of ML0869

  • Can analyze dynamics and conformational changes

  • Works in solution, avoiding crystallization challenges

Cryo-electron microscopy (Cryo-EM):

  • Increasingly powerful for membrane proteins

  • No crystallization required

  • Can capture different conformational states

Small-angle X-ray scattering (SAXS):

  • Provides low-resolution envelope information

  • Useful for analyzing conformational changes upon ligand binding

The structural data can be integrated with computational analysis to identify potential binding sites, catalytic pockets, or interaction interfaces. Structure-guided functional hypotheses can then be tested experimentally through mutagenesis studies targeting key residues. This approach has successfully identified functions for previously uncharacterized proteins, revealing enzymatic mechanisms and potential inhibitor binding sites .

How can machine learning approaches enhance ML0869 functional prediction?

Machine learning (ML) approaches significantly enhance functional prediction for uncharacterized proteins like ML0869 through:

Feature extraction and selection:

  • Sequence-based features (amino acid composition, physicochemical properties)

  • Structure-based features (predicted secondary structure, solvent accessibility)

  • Evolutionary features (conservation patterns, phylogenetic profiles)

Algorithm selection:

  • Support Vector Machines for classification tasks

  • Random Forests for feature importance ranking

  • Deep learning models like Convolutional Neural Networks for pattern recognition

  • Graph Neural Networks for network-based function prediction

Integration of heterogeneous data:

  • Genomic context

  • Transcriptomic data

  • Protein-protein interaction networks

  • Metabolomic data

Recent advances in deep learning architectures are particularly promising, such as attention-based mechanisms that can identify important sequence regions and their contributions to function prediction. These models should be trained on well-annotated mycobacterial proteins to maximize relevance for ML0869 .

The receiver operating characteristics (ROC) analysis performed to evaluate similar methodologies for other uncharacterized proteins yielded an average accuracy of 83% across multiple parameters, demonstrating the power of this approach .

How should researchers handle conflicting results in ML0869 characterization studies?

When encountering conflicting results in ML0869 characterization studies, researchers should implement a systematic troubleshooting approach:

  • Evaluate methodological differences:

    • Expression conditions (temperature, media, strain)

    • Purification strategies and buffer compositions

    • Presence of tags and their potential influence on activity

    • Assay conditions and reagent quality

  • Implement orthogonal validation:

    • Confirm findings using independent techniques

    • Validate biological activity through multiple assays

    • Verify protein integrity via mass spectrometry and circular dichroism

  • Consider protein heterogeneity:

    • Assess oligomerization state and its impact on function

    • Evaluate post-translational modifications

    • Check for truncated forms or degradation products

  • Statistical analysis:

    • Apply mixed methods research approaches combining qualitative and quantitative data

    • Use triangulation to strengthen validity when results converge

    • Implement adequate replication for robust statistical inference

When publishing conflicting findings, researchers should transparently report all experimental conditions and discuss potential sources of variability. This approach not only addresses immediate discrepancies but contributes to better understanding of ML0869's behavior under different conditions, potentially revealing context-dependent functions or regulatory mechanisms .

What are the key considerations for experimental design in ML0869 functional studies?

Robust experimental design for ML0869 functional studies should incorporate:

Statistical power and sample size calculation:

  • Determine appropriate replication based on expected effect sizes

  • Consider hierarchical experimental structures (technical vs. biological replicates)

  • Plan for adequate controls at each experimental level

Variables selection and control:

  • Identify key variables affecting ML0869 expression and activity

  • Use factorial designs to efficiently test multiple variables

  • Implement appropriate randomization and blinding procedures

Data collection planning:

  • Determine primary and secondary outcome measures before experimentation

  • Establish clear criteria for data inclusion/exclusion

  • Plan for time-course studies to capture dynamic processes

Advanced analytical considerations:

  • Account for missing data using appropriate statistical methods

  • Plan for repeated measures analysis where applicable

  • Consider multilevel modeling for complex experimental designs

The table below summarizes key experimental design elements for different ML0869 study types:

Study TypeRecommended DesignKey ControlsSpecial Considerations
Expression OptimizationFractional factorial (2^(8-4))Empty vector, known expressible proteinMonitor cell viability, protein solubility
Functional CharacterizationCompletely randomized designHeat-inactivated protein, catalytic mutantsTest multiple buffer conditions, cofactors
Protein-Protein InteractionsSplit-plot designNon-specific binding controls, competition assaysConsider detergent effects on interactions
In vivo StudiesRandomized block designVehicle control, irrelevant proteinAccount for biological variation, ethical considerations

This structured approach minimizes bias, enhances reproducibility, and maximizes the information gained from resources invested in ML0869 research .

How can advanced data analysis enhance interpretation of ML0869 characterization data?

Advanced data analysis techniques can significantly enhance interpretation of complex ML0869 characterization data:

Multivariate statistical methods:

  • Principal Component Analysis (PCA) to identify patterns across multiple parameters

  • Cluster analysis to identify functional groupings among proteins

  • Multiple regression to understand relationships between variables

Machine learning for pattern recognition:

  • Supervised learning to classify ML0869 variants by activity

  • Unsupervised learning to discover natural groupings in data

  • Feature importance ranking to identify key determinants of function

Time series analysis:

  • For kinetic data from enzymatic assays

  • Dynamic modeling of protein behavior under different conditions

  • Detection of periodic patterns in activity or expression

Network analysis:

  • Integration of ML0869 into protein interaction networks

  • Pathway enrichment analysis for functional context

  • Identification of functional modules containing ML0869

Dealing with missing data:

  • Multiple imputation techniques for incomplete datasets

  • Sensitivity analysis to assess impact of missing values

  • Mixed-effects models to account for unbalanced designs

These advanced analytical approaches can reveal subtle patterns not apparent through conventional analysis. For example, in studies of other uncharacterized proteins, these methods have successfully identified functional clusters, revealing that 37% were enzymes, 13% binding proteins, 21% regulatory proteins, and 6% transport proteins . Similar analysis of ML0869 experimental data could provide insights into its functional classification and biological role.

How might ML0869 research inform development of novel therapeutics for leprosy?

Research on ML0869 has several potential implications for novel therapeutic development against leprosy:

Target validation approaches:

  • Essentiality assessment through conditional expression systems

  • Evaluation of ML0869 conservation across drug-resistant M. leprae strains

  • Analysis of ML0869 expression during different disease stages and treatment response

Drug discovery strategies:

  • Structure-based virtual screening against ML0869 binding pockets

  • Fragment-based drug discovery to identify initial chemical matter

  • Phenotypic screening using ML0869 overexpression or knockdown systems

Therapeutic modalities:

  • Small molecule inhibitors disrupting essential ML0869 functions

  • Peptide-based inhibitors targeting protein-protein interactions

  • Antibody-drug conjugates if ML0869 has accessible extracellular domains

Similar approaches with other uncharacterized proteins have identified virulence factors that could serve as effective drug targets . If ML0869 proves to be involved in critical cellular processes or virulence mechanisms, it could represent a novel therapeutic target. This is particularly valuable for leprosy treatment, where drug resistance has emerged against components of the current multidrug therapy regimen.

What comparative genomics approaches can contextualize ML0869 within mycobacterial biology?

Comparative genomics offers powerful approaches to understand ML0869's evolutionary context and potential functional significance:

Phylogenetic analysis:

  • Construct phylogenetic trees of ML0869 homologs across mycobacterial species

  • Analyze substitution rates to identify selective pressure patterns

  • Examine gene synteny around ML0869 locus across species

Genomic context analysis:

  • Identify conserved gene neighborhoods suggesting functional relationships

  • Examine correlation of ML0869 presence with specific phenotypes

  • Analyze promoter regions for regulatory motifs conserved across species

Pan-genome analysis:

  • Determine if ML0869 belongs to core or accessory genome components

  • Correlate ML0869 sequence variants with host range or virulence

  • Identify horizontal gene transfer events involving ML0869

Structural genomics integration:

  • Compare predicted structural features across orthologous proteins

  • Identify conserved domains suggesting functional constraints

  • Map sequence conservation onto structural models to identify functional sites

This evolutionary context can provide insights into whether ML0869 serves a mycobacteria-specific function or represents a more broadly conserved biological process. Understanding its distribution and conservation patterns across pathogenic and non-pathogenic mycobacteria may suggest its role in virulence or core cellular functions .

What technologies on the horizon might accelerate ML0869 functional characterization?

Several emerging technologies hold promise for accelerating ML0869 functional characterization:

Single-cell technologies:

  • Single-cell transcriptomics to correlate ML0869 expression with cellular states

  • Mass cytometry for high-dimensional analysis of ML0869's impact on cell phenotypes

  • Spatial transcriptomics to map ML0869 expression within infection contexts

Genome editing approaches:

  • CRISPR interference for conditional knockdown in mycobacterial surrogates

  • Base editing for precise mutagenesis of catalytic residues

  • CRISPRa for overexpression studies in native contexts

Structural biology advances:

  • Cryo-electron tomography for in situ structural determination

  • Integrative structural biology combining multiple data types

  • Computational predictions using AlphaFold2 and RoseTTAFold

Proteomics innovations:

  • Thermal proteome profiling to identify ML0869 binding partners

  • Proximity labeling (BioID, APEX) to map protein neighborhoods

  • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

Artificial intelligence integration:

  • Deep learning models for function prediction from sequence/structure

  • Natural language processing of scientific literature for hypothesis generation

  • Automated experimental design optimization

These technologies, particularly when integrated in a multi-omics approach, have the potential to rapidly accelerate our understanding of ML0869 and similar uncharacterized proteins. The application of AI-driven experimental design could significantly reduce the number of experiments needed to characterize ML0869 function, while new structural biology methods may overcome challenges associated with membrane protein analysis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.