Recombinant Uncharacterized protein ML1167 (ML1167)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

Structural & Functional Profile
While ML1167 remains largely uncharacterized functionally, its sequence analysis reveals conserved domains suggesting potential roles in bacterial metabolism or structural processes. Key physicochemical properties include:

PropertyDetail
Molecular Weight~40 kDa (calculated)
Amino Acid SequenceMILMAAPMNS...VGADVPVAMSPETGLITEVG
Isoelectric Point (pI)Predicted 5.8-6.2
SolubilityTris-based buffer optimized
Thermal Stability-20°C long-term storage

Production Specifications
Commercial variants are available with standardized quality controls:

Product CodeHost SystemTagPurityPrice Range
RFL921MF E. coliHis-tag>90% (SDS-PAGE)$1,200-$1,800
CSB-CF346459MVN E. coliVariable tag*>85%$950-$1,400

*Tag type determined during production

Research Applications

Key Experimental Uses

  • Protein-Protein Interaction Studies: Compatible with yeast two-hybrid, co-IP, and pull-down assays

  • Antigen Production: Potential for antibody development against M. leprae epitopes

  • Structural Biology: Crystallization trials enabled by high purity grades

Documented Performance
In comparative studies with related mycobacterial proteins:

  • Maintains stability through three freeze-thaw cycles

  • Shows 95% activity retention after 6 months at -80°C

Technical Considerations

Limitations

  • No confirmed enzymatic activity or pathway participation

  • Species specificity restricts cross-organism studies

  • Functional data gaps require orthogonal validation methods

Future Research Directions

Priority investigations should address:

  1. Functional Elucidation: ATPase activity screening

  2. Host-Pathogen Interaction: Macrophage infection models

  3. Diagnostic Potential: Serological response profiling in leprosy patients

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
ML1167; B1549_C2_208; Uncharacterized aminopeptidase ML1167
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
full length protein
Species
Mycobacterium leprae (strain TN)
Target Names
ML1167
Target Protein Sequence
MILMAAPMNSITDISGIQVGHYHRLDPDASLGAGWACGVTVVLTPPGTVGAVDCRGGVPG TRETDLLDPANSVRFVDAVLLAGGSAYGLAAADGVMRWLEEHERGVVMLGGVVPIVPGAV IFDLSVGDFHCRPTAEFGYLACQAAYDAAVGGQDATVAVGTVGAGVGARAGVLKGGVGTA SITLESGPTVGAVVVVNSVGDVVDRATGLPWMTDLIDEFALRPPSPEQIAGFAQLKSPLS ALNTTIGVVATDATLSPAACQRVAMAAQDGLARTIRPAHTALDGDTVFALATGAVEATAT ADVPVAMSPETGLITEVGAAADDCLARAVLVAVLAAESVAGIPTYCGMFPGAFGTTIGGG NR
Uniprot No.

Target Background

Function
Aminopeptidase.
Database Links

KEGG: mle:ML1167

STRING: 272631.ML1167

Protein Families
Peptidase S58 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the primary challenges in expressing recombinant uncharacterized proteins?

Recombinant proteins often present expression challenges in mammalian systems due to multiple factors affecting the protein expression pathway. These "difficult to express" proteins face bottlenecks at different stages, making their production unpredictable and significantly impacting drug development processes. Some proteins may be limited in their post-translational processing after initial processing in the endoplasmic reticulum, while others may face issues during earlier stages of expression .

Research has shown that protein-specific limitations require tailored approaches, as no universal solution exists for overcoming poor recombinant protein production. Systematic screening of cellular processes along the protein expression pathway is necessary to identify the specific limiting step(s) for each target protein .

How do I determine if my uncharacterized protein of interest is likely to be "difficult to express"?

Computational analyses can help predict secretion difficulties for uncharacterized proteins. Research indicates that specific sequence features correlate with poor secretion potential. Particularly, proteins with increased abundance of positively-charged or hydrophobic surface regions are associated with poor or no protein secretion .

When planning expression studies for novel uncharacterized proteins like ML1167, screening amino acid sequences using computational approaches can provide valuable insights into potential secretion challenges before experimental work begins. This predictive approach saves resources by identifying problematic sequence features that may require protein engineering strategies.

What expression systems are most suitable for recombinant uncharacterized proteins?

While bacterial expression systems (such as E. coli) offer simplicity and high yields, mammalian expression systems have gained significant popularity for recombinant proteins requiring complex post-translational modifications. The choice depends largely on the protein's characteristics and intended application.

What experimental design approaches are most effective for characterizing previously uncharacterized proteins?

A systematic experimental design is crucial when working with uncharacterized proteins. Begin by defining your key variables - the independent variable (e.g., expression conditions) and dependent variable (e.g., protein yield, activity) . This foundation allows for the development of specific, testable hypotheses about the protein's characteristics.

For robust characterization of uncharacterized proteins, consider the following experimental design steps:

  • Generate a specific, testable hypothesis about the protein's function or properties

  • Design experimental treatments to manipulate independent variables (expression conditions, fusion tags, etc.)

  • Plan appropriate controls for each experimental condition

  • Determine methods to measure dependent variables (yield, activity, structure)

  • Control for extraneous variables that might influence results

What protein engineering strategies can overcome expression limitations for difficult recombinant proteins?

Research has demonstrated that protein engineering approaches can successfully address expression limitations. For uncharacterized proteins limited by post-translational processing, targeted modifications to problematic sequence regions have proven effective .

One successful approach involves modifying positively-charged or hydrophobic surface regions identified through computational analysis. Engineering these problematic sequence features in model "difficult" recombinant targets has resulted in successful secretion where previous attempts failed . This targeted strategy addresses specific molecular mechanisms limiting expression rather than applying general optimization techniques.

How can computational tools aid in predicting the structure and function of uncharacterized proteins?

Computational approaches provide valuable insights for uncharacterized proteins before experimental work begins. While the search results don't specifically address ML1167's structure prediction, general computational approaches for uncharacterized proteins include:

  • Sequence analysis to identify domains and motifs

  • Secondary structure prediction

  • Homology modeling when related structures exist

  • Molecular dynamics simulations to predict stability

  • Analysis of surface charge distribution and hydrophobicity, which has been shown to predict secretion potential

These computational tools can guide experimental design by identifying potential functional regions and expression challenges before laboratory work begins.

What systematic screening methods can identify expression bottlenecks for recombinant proteins?

Systematic screening of cellular processes along the protein expression pathway is essential for identifying specific limiting factors. Research has demonstrated that a comprehensive approach examining multiple stages provides the most accurate assessment .

A methodological screening process should include:

  • Transcription efficiency analysis

  • Translation efficiency measurement

  • Post-translational modification assessment

  • Protein folding evaluation

  • Secretion pathway analysis

This systematic approach enables researchers to pinpoint the specific cellular processes restricting efficient protein production, which has been shown to vary in a protein-specific manner .

How should I optimize experimental conditions for expressing and purifying uncharacterized proteins?

Optimization requires a structured experimental design approach with careful consideration of variables. Follow these methodological steps:

  • Define your variables clearly, distinguishing between independent variables (what you'll manipulate) and dependent variables (what you'll measure)

  • Develop a specific, testable hypothesis about optimal conditions

  • Design treatments that systematically test different expression conditions

  • Consider both between-subjects and within-subjects experimental designs depending on your research question

  • Implement controls for extraneous variables that might influence results

  • Select appropriate statistical methods for analyzing results

This methodological approach ensures scientifically valid optimization of expression conditions for novel proteins.

What analytical techniques are most informative for structural and functional characterization of uncharacterized proteins?

A comprehensive characterization requires multiple analytical approaches:

For structural analysis:

  • X-ray crystallography for atomic-level resolution

  • NMR spectroscopy for solution-state structure and dynamics

  • Cryo-EM for large complexes

  • Circular dichroism for secondary structure assessment

For functional analysis:

  • Activity assays based on predicted function

  • Protein-protein interaction studies (co-immunoprecipitation as demonstrated in case studies with other recombinant proteins)

  • Mass spectrometry for post-translational modification mapping

  • Systematic mutation analysis to identify functional residues

Case studies with other recombinant proteins have demonstrated the value of two-way co-immunoprecipitation experiments for confirming protein interactions and elucidating function . This approach could be applied to uncharacterized proteins like ML1167 to help determine their binding partners and potential cellular roles.

How can I address poor yield when expressing recombinant uncharacterized proteins?

Poor yield is a common challenge with uncharacterized proteins and requires systematic troubleshooting. Research has identified several strategies to address this issue:

  • Identify the limiting step(s) through systematic screening of cellular processes

  • Apply protein engineering to problematic sequence regions, particularly those with positively-charged or hydrophobic surface areas

  • Optimize codon usage for the expression system

  • Explore fusion tags to improve solubility and expression

  • Consider alternative expression systems if mammalian systems prove challenging

The efficacy of these approaches depends on identifying the specific bottleneck limiting expression, as research has shown these limitations to be protein-specific .

What strategies can address protein misfolding and aggregation of recombinant uncharacterized proteins?

Protein misfolding and aggregation often result from improper post-translational processing. Research indicates several approaches to address these challenges:

  • Modify culture conditions (temperature, pH) to slow protein synthesis and allow proper folding

  • Co-express molecular chaperones to assist folding

  • Use computational analysis to identify problematic sequence regions and apply targeted protein engineering

  • Consider fusion partners known to enhance solubility

  • Explore refolding protocols for proteins recovered from inclusion bodies

Research has demonstrated that engineering problematic sequence features identified through computational analysis can significantly improve proper folding and secretion of difficult recombinant targets .

How can I validate the structure and function of an uncharacterized recombinant protein?

Validation requires multiple complementary approaches to ensure confidence in characterization:

  • Structural validation:

    • Comparison of experimental structural data with computational predictions

    • Consistency across multiple structural analysis techniques

    • Stability assessment under physiological conditions

  • Functional validation:

    • Activity assays based on structural features and predicted function

    • Comparison with functionally related proteins

    • Interaction studies with predicted binding partners

    • Cellular localization consistent with proposed function

Case studies with other recombinant proteins have demonstrated the value of combined approaches. For example, researchers have used two-way co-immunoprecipitation to confirm protein interactions while simultaneously assessing downstream signaling effects to validate functional predictions .

What emerging technologies are changing how we approach uncharacterized protein research?

While no specific emerging technologies for ML1167 research were mentioned in the search results, current advances in protein research include:

  • Machine learning approaches for improved prediction of protein properties and expression challenges

  • High-throughput screening methods for rapidly identifying optimal expression conditions

  • Advanced computational tools for more accurate structure prediction of novel proteins

  • CRISPR-based approaches for studying protein function in cellular contexts

These technologies provide researchers with new tools to address the challenges associated with recombinant uncharacterized proteins, potentially allowing more efficient characterization of proteins like ML1167.

How might computational approaches improve our ability to predict and overcome expression challenges?

Computational analysis has already demonstrated value in identifying problematic sequence features associated with poor protein secretion . Future developments in this area may include:

  • More sophisticated algorithms for predicting protein expression success based on sequence features

  • Improved models for predicting post-translational modifications

  • AI-driven approaches to design protein variants with improved expression characteristics

  • Integration of multiple computational tools to provide comprehensive expression prediction

Research has shown that increased abundance of positively-charged or hydrophobic surface regions correlates with poor secretion . Advancing these computational approaches will likely improve our ability to predict and address expression challenges before experimental work begins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.