Recombinant Uncharacterized protein ML1171 (ML1171)

Shipped with Ice Packs
In Stock

Description

Table 1: Physicochemical Properties of ML1171

PropertyDetail
Amino Acid Length251 residues
Molecular Weight~27.6 kDa (calculated)
Theoretical pINot explicitly reported
Expression Region1-251 (full-length)
TagHis-tag or untagged (varies by product)
Storage Stability12 months at -20°C/-80°C (lyophilized)

The protein’s amino acid sequence begins with MTPTGDWYKGG and features hydrophobic regions suggestive of membrane-associated functions . Structural studies remain pending, though homology modeling might reveal conserved domains in future work.

Production and Purification

ML1171 is typically expressed in E. coli systems for cost-effectiveness and scalability . Post-purification protocols involve:

  • Chromatography: Affinity purification using His-tag systems .

  • Buffer Formulation: Tris/PBS-based buffers with 50% glycerol to enhance stability .

  • Purity: >85%–90% as verified by SDS-PAGE .

Table 2: Recombinant Production Details

ParameterSpecification
Host SystemE. coli, yeast, mammalian cells
Reconstitution0.1–1.0 mg/mL in deionized water
Shelf Life (Liquid)6 months at -20°C/-80°C

Vaccine Development

ML1171 is prioritized in leprosy vaccine research due to its surface-exposed epitopes in M. leprae. Creative Biolabs highlights its utility in immunogenicity studies and adjuvant testing .

Diagnostic Assays

The protein is used in ELISA kits to detect anti-M. leprae antibodies, aiding in early leprosy diagnosis . Its specificity reduces cross-reactivity with other mycobacterial species .

Functional Studies

While ML1171’s biological role is undefined, its gene locus (mL1171) suggests involvement in metabolic or virulence pathways . Current studies focus on:

  • Interactions with host immune cells.

  • Comparative genomics with M. tuberculosis proteins .

Challenges and Future Directions

  • Functional Annotation: ML1171’s role in M. leprae pathogenesis remains unverified. Structural genomics and knock-out studies are needed .

  • Thermostability: The protein’s instability index (~57.75 in homologs) suggests sensitivity to temperature fluctuations, necessitating optimized storage .

  • Drug Target Potential: Virtual screening of homologs identified ligands with high binding affinity, hinting at ML1171’s utility in antimicrobial design .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requests. Please specify your preferred format when placing your order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
ML1171; B1549_C3_240; Uncharacterized protein ML1171
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Mycobacterium leprae (strain TN)
Target Names
ML1171
Target Protein Sequence
MTPTGDWYKGGDEVGAPSACGGGSALMTLPEKNLGYKPETETNRRLRWMVGGVTILTFMA LLYLVELIDQLTRHSLDNNGIRLLKTDVLWGISFAPVLHANWQHLVANTIPLLVLGFLIA LAGLSRFIWVTAMVWIFGGSATWLIGNMGSSFGPTDHIGVSGLIFGWLAFLLVFGLFVRR GWDIIGCMVLFAYGGVLLGVMPVLGRCGGVSWQGHLCGAISGVVAAYLLSAPERKTRALK EAGTDSPRLKT
Uniprot No.

Target Background

Database Links

STRING: 272631.ML1171

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What exactly is an uncharacterized protein like ML1171, and why is it important to study?

Uncharacterized proteins (also referred to as hypothetical proteins) are predicted to be expressed from an open reading frame but lack experimental evidence confirming their function, subcellular localization, or role in biological processes . ML1171 exemplifies such proteins that may play significant roles in cellular processes despite our limited knowledge about them.

Studying uncharacterized proteins is crucial because:

  • They represent a substantial fraction of proteomes in both prokaryotes and eukaryotes

  • They may serve as novel therapeutic targets

  • They could reveal new biological mechanisms and pathways

  • Understanding their functions contributes to comprehensive genome annotation

Methodological approach: Begin with sequence retrieval from genomic databases, followed by similarity analysis using BLASTp to identify potential homologs across species. This provides initial clues about evolutionary conservation and possible functional importance .

What general approaches should be employed in the preliminary characterization of ML1171?

A multi-faceted approach combining computational and experimental techniques is recommended:

  • Sequence analysis: Perform multiple sequence alignments to identify conserved regions that might indicate functional domains

  • Physicochemical characterization: Determine basic properties using tools like ExPASy ProtParam

  • Domain analysis: Search for conserved domains using INTERPRO, MOTIF, Pfam, and NCBI's conserved domain database

  • Structural prediction: Generate tertiary structure models using Swiss Model and D-I-TASSER servers

  • Subcellular localization prediction: Use CELLO, PSORTb, and related tools

  • Expression analysis: Examine when and where the protein is expressed

Example of physicochemical properties typically analyzed:

PropertyTypical Value for Uncharacterized ProteinsSignificance
Molecular weight13,456.43 Da (example)Informs purification strategies
Theoretical pI5.74 (example)Indicates protein charge at physiological pH
GRAVY value0.002 (example)Indicates hydrophobicity/hydrophilicity
Instability index57.75 (example)Values >40 suggest instability
Estimated half-life30h (mammalian reticulocytes)Indicates protein stability in different systems

These preliminary analyses provide a foundation for more targeted experimental approaches .

How should I design an optimal expression system for recombinant ML1171 production?

Designing an effective expression system requires careful consideration of multiple variables. A factorial design approach is recommended to systematically optimize expression conditions:

  • Select an appropriate expression vector: Consider codon optimization for the host organism and appropriate promoter strength

  • Choose a suitable host organism: E. coli BL21 Star (DE3) is often used for initial attempts due to its robustness

  • Design a multivariate experimental approach: Rather than changing one variable at a time, use a factorial design to evaluate multiple variables simultaneously

  • Include key variables in your design:

    • Induction absorbance (cell density at induction)

    • Inducer concentration (e.g., IPTG)

    • Expression temperature

    • Media composition (yeast extract, tryptone, glucose concentrations)

    • Antibiotic concentration

    • Induction time

Methodological recommendation: Implement a 2^n factorial design or fractional factorial design (e.g., 2^8-4 as shown in search result ) to efficiently identify optimal conditions while minimizing the number of experiments required .

What specific variables significantly affect soluble expression of recombinant proteins like ML1171?

Based on experimental design studies, the following variables have been identified as statistically significant for soluble protein expression:

VariableOptimal Directionp-valueEffect on Solubility
Induction absorbanceHigher (0.8 A600)<0.0001Positive
IPTG concentrationLower (0.1 mM)0.0387Negative at higher levels
Expression temperatureLower (25°C)<0.0001Negative at higher temps
Yeast extract concentrationModerate (5 g/L)0.0004Positive
Tryptone concentrationModerate (5 g/L)0.0027Positive
Glucose concentrationModerate (1 g/L)0.0685Positive

Methodological approach: Initialize expression trials using conditions optimized for similar proteins, then refine through factorial design experiments. For ML1171, starting conditions of 25°C expression temperature, 0.1 mM IPTG, and induction at OD600 of 0.8 could be appropriate based on similar uncharacterized protein expression studies .

How can I validate that my recombinant ML1171 has proper folding and functionality?

Without knowing the specific function of ML1171, validation requires multiple complementary approaches:

  • Structural validation:

    • Circular dichroism (CD) spectroscopy to assess secondary structure elements

    • Size exclusion chromatography to evaluate oligomeric state

    • Thermal shift assays to determine stability

    • Limited proteolysis to probe for well-folded domains

  • Functional validation:

    • Design activity assays based on predicted function from domain analysis

    • If domain predictions suggest enzymatic activity, test relevant substrates

    • Protein-protein interaction studies to identify binding partners

    • If homology to characterized proteins exists, adapt established functional assays

  • Quality assessment tools for structural models:

    • Ramachandran plot analysis (PROCHECK server)

    • VERIFY 3D and ERRAT servers for predicted structure evaluation

    • ProSA server for Z-score computation

Methodological recommendation: Develop multiple orthogonal validation methods rather than relying on a single technique, especially for proteins with unknown function .

What computational approaches are most effective for predicting the function of ML1171?

A hierarchical computational approach is recommended:

  • Sequence-based analysis:

    • PSI-BLAST for distant homology detection

    • Multiple sequence alignment to identify conserved residues

    • Motif scanning using PROSITE, PRINTS, or similar databases

  • Structure-based prediction:

    • Threading-based methods (I-TASSER, PHYRE2)

    • Ab initio structure prediction (Rosetta, AlphaFold)

    • Structure comparison with known proteins (DALI, TM-align)

  • Function prediction tools:

    • Gene ontology term prediction

    • Protein-protein interaction network analysis using STRING

    • Integrated function prediction platforms (SIFTER, ProFunc)

  • Molecular dynamics simulations:

    • Analyze conformational flexibility

    • Identify potential binding pockets

    • Evaluate stability of predicted structures

Methodological note: Combining multiple computational approaches increases confidence in predictions. For ML1171, start with conserved domain analysis to identify potential functional domains, then proceed to more sophisticated structural prediction methods .

What techniques are most effective for determining the subcellular localization of ML1171?

Determining subcellular localization involves both computational prediction and experimental validation:

  • Computational prediction tools:

    • CELLO (reliability score example: 3.301)

    • PSORTb (especially for bacterial proteins)

    • CCTOP (for transmembrane protein prediction)

    • SOSUIGramN and PSLpred (complementary tools)

  • Experimental validation methods:

    • Fluorescent protein tagging and microscopy

    • Subcellular fractionation followed by Western blotting

    • Immunofluorescence with antibodies against the target protein

    • Proximity labeling methods (BioID, APEX)

Methodological recommendation: Always validate computational predictions experimentally. For ML1171, if computational tools predict cytoplasmic localization (like the example in search result with a reliability score of 3.301), design experiments to confirm this prediction using GFP tagging or subcellular fractionation .

How can domain analysis help identify the potential function of ML1171?

Domain analysis provides critical insights into protein function:

  • Domain identification process:

    • Submit sequence to NCBI's CD-search, Pfam, INTERPRO

    • Identify conserved domains with significant e-values

    • Note the amino acid range covered by the domain

  • Functional inference:

    • Research known functions of identified domains

    • Examine proteins with similar domain architecture

    • Consider domain combinations that may suggest novel functions

  • Example from similar analyses:

    • In the case study from search result , an uncharacterized protein was found to contain a Mth938-like domain (e-value: 3.78e-51)

    • This domain suggested a role in preadipocyte differentiation and adipogenesis

    • Such findings guided subsequent experimental validation

How can molecular docking studies inform our understanding of ML1171's potential interactions?

Molecular docking provides insights into potential ligand binding and protein function:

  • Ligand selection strategies:

    • Select ligands based on predicted function from domain analysis

    • Focus on compounds relevant to the biological context

    • Consider both natural substrates and potential inhibitors

  • Docking procedure:

    • Obtain ligand structures from PubChem

    • Convert to appropriate format using PyMOL

    • Perform docking using AutoDock Vina through PyRx

    • Analyze results with PyMOL and Discovery Studio

  • Interaction analysis:

    • Identify key binding residues

    • Characterize hydrogen bonding and hydrophobic interactions

    • Calculate binding affinities

  • Validation approaches:

    • Perform molecular dynamics simulations of docked complexes

    • Design site-directed mutagenesis experiments for key residues

    • Develop binding assays to confirm predictions experimentally

Methodological recommendation: For ML1171, identify potential binding pockets in the predicted structure, then select ligands based on domain predictions and perform systematic docking studies followed by experimental validation of high-confidence predictions .

How should I approach contradictory data when characterizing ML1171?

Resolving contradictory data requires systematic analysis:

  • Data evaluation framework:

    • Assess reliability of different methods (computational vs. experimental)

    • Consider sensitivity and specificity of each technique

    • Evaluate statistical significance of conflicting results

    • Prioritize orthogonal methods that reinforce each other

  • Resolution strategies:

    • Design additional experiments to address specific contradictions

    • Employ alternative techniques that may resolve ambiguities

    • Consider if contradictions represent genuine biological complexity

    • Consult with specialists in techniques giving contradictory results

  • Integrative approach:

    • Develop weighted evidence schemes

    • Use Bayesian integration of multiple data sources

    • Consider if contradictions suggest multiple functions or conformational states

Methodological insight: Contradictions often reveal new biological insights. For ML1171, systematically document contradictory findings and design targeted experiments to resolve them rather than discarding inconvenient data .

What experimental design approaches can optimize ML1171 production for structural studies?

High-yield, high-purity protein production requires sophisticated optimization:

  • Statistical experimental design methodology:

    • Apply multivariate analysis instead of univariate optimization

    • Use factorial or fractional factorial designs to efficiently explore parameter space

    • Include central points to detect curvature in response surfaces

  • Key parameters to optimize:

    • Expression host strain selection

    • Vector design (fusion tags, protease cleavage sites)

    • Media formulation (defined vs. complex media)

    • Induction parameters (temperature, inducer concentration, timing)

    • Cell lysis and initial purification steps

  • Example optimization outcomes from similar studies:

ConditionValueCell Growth (Abs)Protein ActivityProductivity
Optimized0.8 Abs ind, 0.1 mM IPTG, 25°C, 5 g/L YE, 5 g/L tryptone, 1 g/L glucose2.08612 HU/mL1.77 HU/mL/min
Central point1.4 Abs ind, 0.55 mM IPTG, 31°C, 14.3 g/L YE, 5 g/L tryptone, 5.5 g/L glucose3.321263 HU/mL3.41 HU/mL/min

Methodological recommendation: For ML1171, design a fractional factorial experiment (e.g., 2^8-4) to identify significant variables, then perform response surface methodology around optimal conditions to maximize soluble protein yield .

How can mass spectrometry contribute to ML1171 characterization?

Mass spectrometry offers powerful analytical capabilities for protein characterization:

  • Protein identification and verification:

    • Confirm protein identity and sequence

    • Identify post-translational modifications

    • Determine absolute mass for quality control

  • Structural characterization:

    • Hydrogen-deuterium exchange MS for conformational analysis

    • Chemical cross-linking MS for spatial constraints

    • Native MS for oligomeric state determination

  • Interaction studies:

    • Affinity purification-MS to identify binding partners

    • Protein-ligand binding analysis

    • Quantitative interaction proteomics

  • Experimental approach:

    • Matrix-assisted laser desorption ionization-MS (MALDI-MS) for identification

    • Liquid chromatography-tandem MS (LC-MS/MS) for detailed characterization

    • Data-independent acquisition for comprehensive analysis

Methodological insight: For ML1171, MS can confirm recombinant protein identity and purity, identify post-translational modifications not predicted from sequence alone, and help establish binding partners through affinity purification-MS experiments .

How can I design a systematic research network to facilitate ML1171 characterization?

Creating an effective research network enhances characterization efficiency:

  • Network components:

    • Computational biology collaborators for structure prediction

    • Structural biology partners for experimental structure determination

    • Functional genomics teams for high-throughput phenotypic screening

    • Biochemistry specialists for in vitro characterization

    • Cell biology experts for in vivo validation

  • Collaboration framework:

    • Regular data sharing and integration meetings

    • Standardized protocols across laboratories

    • Centralized data repository

    • Clearly defined project milestones

  • Resource optimization:

    • Distribution of specialized techniques across network

    • Sharing of expensive equipment and resources

    • Coordinated publication strategy

Methodological recommendation: For ML1171, establish a multi-disciplinary network with complementary expertise, ensuring regular communication and data sharing to accelerate characterization efforts .

What are the most reliable approaches for determining if ML1171 has enzymatic activity?

Systematic enzymatic activity screening requires strategic experimental design:

  • Activity prediction-based screening:

    • Design assays based on domain predictions and structural similarities

    • Test substrate panels related to predicted function

    • Include control proteins with established activities

  • Unbiased activity screening:

    • Substrate profiling using metabolite libraries

    • High-throughput enzymatic assays with diverse substrate classes

    • Activity-based protein profiling with chemical probes

  • Validation and characterization:

    • Determine kinetic parameters (Km, kcat, specificity constants)

    • Analyze cofactor requirements

    • Perform site-directed mutagenesis of predicted catalytic residues

    • Evaluate pH and temperature optima

Methodological insight: For ML1171, begin with assays directed by domain predictions (e.g., if an Mth938-like domain is identified, test activities related to adipogenesis), then expand to broader substrate profiling if initial screens are negative .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.