Recombinant Uncharacterized protein ML1176 (ML1176)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ML1176; B1549_F2_59; MLCB1701.02c; Uncharacterized protein ML1176
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Mycobacterium leprae (strain TN)
Target Names
ML1176
Target Protein Sequence
MTRPETPQAPDFDFEKSRTALLGYRIMAWTTGIWLIALCYEIVSHLVFHHEIRWIEVVHG WVYFVYVLTAFNLAIKVRWPIGKTVGVLLAGTVPLLGIIVEHFQTKDVKTRFGLRHSRT
Uniprot No.

Target Background

Database Links

KEGG: mle:ML1176

STRING: 272631.ML1176

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the predicted structure and function of ML1176 protein?

ML1176 is an uncharacterized protein that likely requires comprehensive structural analysis to determine its functional properties. Researchers should approach this question through multiple complementary methods including protein sequence analysis, homology modeling, and experimental structure determination. Initial characterization typically begins with bioinformatic analysis of the amino acid sequence to identify conserved domains, motifs, and potential functional sites. Computational modeling may provide preliminary structural insights, but experimental validation through X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy would be necessary for definitive structural characterization.

What expression systems are optimal for recombinant ML1176 production?

The selection of an appropriate expression system for ML1176 depends on several factors including protein size, complexity, post-translational modifications, and intended downstream applications. Based on general protocols for uncharacterized proteins, researchers should consider:

  • Prokaryotic systems (E. coli): Suitable for rapid, high-yield expression if the protein doesn't require extensive post-translational modifications

  • Yeast systems (P. pastoris, S. cerevisiae): Offer eukaryotic processing capabilities with relatively high yields

  • Insect cell systems: Provide more complex post-translational modifications while maintaining reasonable yields

  • Mammalian cell systems: Offer the most authentic eukaryotic processing but with typically lower yields

Each system requires optimization of expression conditions including temperature, induction parameters, and purification strategies. Pilot experiments testing multiple expression systems in parallel are recommended for initial characterization of ML1176.

What are the standard purification protocols for ML1176?

Purification of recombinant ML1176 would typically follow established protein purification principles. A methodological approach would include:

  • Selection of appropriate affinity tags (His-tag, GST, etc.) based on expression system

  • Initial capture using affinity chromatography

  • Secondary purification steps using ion exchange chromatography

  • Polishing steps with size exclusion chromatography

  • Validation of purity using SDS-PAGE and Western blotting

The specific buffer conditions, including pH, salt concentration, and additives, would need to be optimized through empirical testing. For uncharacterized proteins like ML1176, it's advisable to perform stability tests under various buffer conditions to identify optimal purification and storage parameters.

How can I confirm the identity and purity of recombinant ML1176?

Verification of ML1176 identity and purity requires multiple analytical approaches:

Analytical MethodPurposeExpected Results
SDS-PAGEAssess purity and apparent molecular weightSingle band at predicted molecular weight
Western blotConfirm identity using tag-specific or custom antibodiesSpecific binding at target molecular weight
Mass spectrometryVerify protein sequence and detect modificationsPeptide fragments matching predicted sequence
Size exclusion chromatographyAssess oligomeric state and aggregationSingle peak at expected hydrodynamic radius
Circular dichroismEvaluate secondary structure contentSpectrum consistent with predicted structure

These complementary techniques provide a comprehensive assessment of protein identity, purity, and structural integrity necessary for subsequent functional studies.

What bioinformatic approaches can predict ML1176 function?

For uncharacterized proteins like ML1176, computational prediction offers initial functional insights. A systematic approach would include:

  • Sequence-based analysis:

    • BLAST searches against characterized proteins

    • Multiple sequence alignments to identify conserved residues

    • Motif scanning using databases like PROSITE, Pfam, and InterPro

  • Structure-based prediction:

    • Homology modeling using related characterized proteins as templates

    • Threading algorithms to identify structural homologs

    • Molecular docking simulations to predict potential binding partners

  • Evolutionary analysis:

    • Phylogenetic profiling to identify co-evolving proteins

    • Gene neighborhood analysis to identify functional associations

    • Comparative genomics to identify conserved operons or gene clusters

These computational approaches provide testable hypotheses about ML1176 function that can guide subsequent experimental design .

How can protein-protein interactions of ML1176 be identified?

Characterizing the interactome of ML1176 requires multiple complementary approaches:

  • In vitro methods:

    • Pull-down assays using recombinant ML1176 as bait

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic characterization

  • Cell-based methods:

    • Yeast two-hybrid screening

    • Proximity labeling approaches (BioID, APEX)

    • Co-immunoprecipitation followed by mass spectrometry

  • In silico prediction:

    • Protein-protein interaction databases

    • Machine learning algorithms trained on known interaction networks

    • Molecular dynamics simulations

A recommended workflow would begin with computational prediction, followed by high-throughput screening methods, with detailed characterization of identified interactions using biophysical techniques.

What enzymatic activity assays are appropriate for ML1176?

Without specific information about ML1176's predicted function, researchers should consider a systematic screening approach:

  • Generic activity assays:

    • ATPase/GTPase activity (if P-loop motifs are present)

    • Protease/hydrolase activity using fluorogenic substrates

    • DNA/RNA binding using electrophoretic mobility shift assays

  • Targeted assays based on structural predictions:

    • If structural analysis suggests similarity to known enzymes, specific substrate panels can be tested

    • Activity-based protein profiling using chemical probes

  • Functional complementation:

    • Expression in mutant cell lines lacking proteins with similar predicted functions

    • Rescue experiments to determine functional conservation

The selection of appropriate assays depends on bioinformatic predictions and preliminary characterization results.

How can I resolve contradictory data in ML1176 functional studies?

When facing contradictory experimental results, a systematic approach to resolution is necessary:

  • Evaluate methodological differences:

    • Compare experimental conditions including buffer composition, temperature, and pH

    • Assess protein preparation methods (tags, purification protocols)

    • Review analytical techniques and their limitations

  • Consider biological variables:

    • Post-translational modifications affecting activity

    • Presence/absence of cofactors or binding partners

    • Conformational states or oligomerization effects

  • Design validation experiments:

    • Use orthogonal techniques to test the same hypothesis

    • Perform mutagenesis studies to identify critical residues

    • Conduct structure-function analysis under controlled conditions

As demonstrated in studies of other uncharacterized proteins, apparent contradictions often reveal important regulatory mechanisms or context-dependent functions .

What approaches can differentiate between direct and indirect effects in ML1176 knockout/knockdown studies?

Distinguishing primary from secondary effects in ML1176 perturbation studies requires careful experimental design:

  • Temporal analysis:

    • Time-course experiments to establish sequence of events

    • Inducible or rapidly acting depletion systems (e.g., auxin-inducible degron)

  • Rescue experiments:

    • Complementation with wild-type ML1176

    • Domain-specific or function-specific mutants to map required regions

  • Direct interaction validation:

    • In vitro reconstitution of observed effects with purified components

    • Proximity labeling to identify spatially close interactors during functional events

  • Systems biology approaches:

    • Network analysis to distinguish hub effects from peripheral changes

    • Pathway enrichment analysis of differential expression/modification data

These approaches collectively build evidence for causal relationships versus secondary effects in functional studies.

How can structural dynamics of ML1176 be characterized?

Understanding the conformational flexibility of ML1176 requires specialized techniques:

  • Solution-based methods:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Small-angle X-ray scattering (SAXS)

    • Nuclear magnetic resonance (NMR) relaxation measurements

  • Single-molecule techniques:

    • Förster resonance energy transfer (FRET) with strategic fluorophore labeling

    • Atomic force microscopy for conformational distributions

    • Single-molecule force spectroscopy

  • Computational approaches:

    • Molecular dynamics simulations at different timescales

    • Normal mode analysis for identifying potential conformational changes

    • Markov state modeling of conformational landscapes

These techniques provide complementary insights into ML1176's structural dynamics, which may be crucial for understanding its biological function .

What controls are essential for ML1176 functional assays?

Rigorous experimental design for ML1176 characterization must include appropriate controls:

Control TypePurposeExample
Positive controlValidate assay functionalityWell-characterized protein with similar predicted function
Negative controlEstablish baseline/backgroundBuffer-only or inactive mutant protein
Specificity controlConfirm target specificityClosely related protein or point mutants of ML1176
Technical controlsAccount for experimental artifactsTag-only protein, heat-denatured ML1176
Biological controlsControl for systemic effectsParallel analysis in different cell types or organisms

Including these controls enables confident interpretation of results and helps distinguish ML1176-specific effects from experimental artifacts.

How should ML1176 mutations be designed for structure-function analysis?

Strategic design of ML1176 mutants requires consideration of several factors:

  • Conservation-based targeting:

    • Mutations of highly conserved residues across orthologs

    • Substitution of residues that define protein subfamilies

  • Structure-based design:

    • Disruption of predicted active sites or binding interfaces

    • Alteration of residues involved in conformational changes

    • Stabilization or destabilization of specific structural elements

  • Functional validation design:

    • Alanine scanning of regions with predicted functions

    • Conservative vs. non-conservative substitutions

    • Introduction of biochemically traceable residues (e.g., cysteine for crosslinking)

  • Controls:

    • Surface mutations distant from functional sites

    • Synonymous mutations for genetic studies

A systematic mutagenesis approach combined with functional readouts provides a powerful strategy to map structure-function relationships in ML1176.

What are the best practices for reproducibility in ML1176 research?

Ensuring reproducible results in ML1176 characterization requires:

  • Detailed reporting of experimental conditions:

    • Complete protein expression and purification protocols

    • Buffer compositions including pH, salt concentrations, and additives

    • Instrument parameters and settings for all analytical methods

  • Quality control standards:

    • Protein batch validation protocols (purity, activity, stability)

    • Acceptance criteria for experimental replicates

    • Statistical methods appropriate for data type and distribution

  • Data management:

    • Raw data preservation and accessibility

    • Processing pipelines with version control

    • Structured metadata describing experimental variables

  • Validation across systems:

    • Testing in multiple expression systems or cell types

    • Cross-validation using orthogonal techniques

    • Independent replication of key findings

Following these practices supports cumulative knowledge building about ML1176 and facilitates collaboration among research groups.

How does ML1176 research relate to systems biology approaches?

Integrating ML1176 research into systems biology frameworks provides context for its function:

  • Network integration:

    • Placement of ML1176 within protein-protein interaction networks

    • Metabolic pathway analysis if enzymatic function is identified

    • Regulatory network mapping through transcriptomic/proteomic studies

  • Multi-omics approaches:

    • Correlation of ML1176 expression/activity with global cellular states

    • Identification of condition-specific roles through perturbation studies

    • Co-expression analysis to identify functional modules

  • Evolutionary context:

    • Comparative genomics across species possessing ML1176 orthologs

    • Analysis of selection pressure on different protein domains

    • Reconstruction of functional evolution through ancestral sequence reconstruction

These integrative approaches situate ML1176 within broader biological systems and help predict its role in cellular homeostasis.

What computational resources are available for ML1176 analysis?

Researchers studying ML1176 can leverage numerous bioinformatic tools:

  • Sequence analysis resources:

    • UniProt, NCBI, and specialized protein databases

    • Multiple sequence alignment tools (MUSCLE, MAFFT, T-Coffee)

    • Motif recognition software (MEME, HMMER)

  • Structure prediction platforms:

    • AlphaFold2 and RoseTTAFold for ab initio structure prediction

    • SWISS-MODEL and I-TASSER for homology modeling

    • PDB for structural comparisons if homologs exist

  • Functional prediction tools:

    • Gene Ontology enrichment analysis

    • KEGG and Reactome for pathway mapping

    • STRING and BioGRID for interaction network analysis

  • Specialized resources:

    • Protein stability prediction tools

    • Post-translational modification site predictors

    • Subcellular localization prediction algorithms

These computational resources provide a foundation for hypothesis generation and experimental design in ML1176 research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.