Recombinant Uncharacterized protein ML1177 (ML1177)

What is ML1177 and what expression systems are recommended for its recombinant production?

ML1177 (also known as lprD) is an uncharacterized protein from Mycobacterium leprae with UniProt ID P54134. It is a full-length protein consisting of 126 amino acids with the sequence: "MSTTRRRRPALVALVTIAACGCLALGWWQWTRFQSASGTFQNLGYALQWPLFAGFCLYTYHNFVRYEESPPQPRHMNCIAEIPPELLPARPKPEQQPPDDPALRKYNTYLAELAKQDAENHNRTTT" .

For recombinant expression, multiple systems can be utilized:

• E. coli: Offers the highest yields and fastest turnaround times

• Yeast: Provides good yields with some post-translational modifications

• Insect cells with baculovirus: Provides many necessary post-translational modifications

• Mammalian cells: Optimal for retaining protein activity through proper folding and modifications

When selecting an expression system, researchers should consider their specific experimental requirements, including protein yield, purity needs, post-translational modification requirements, and timeline constraints.

What storage conditions are optimal for maintaining ML1177 stability?

For optimal stability of recombinant ML1177:

• Store lyophilized powder at -20°C/-80°C upon receipt

• Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

• For reconstituted protein, store working aliquots at 4°C for up to one week

• For extended storage, add glycerol (recommended final concentration 50%) and store at -20°C or -80°C

The recommended storage buffer is a Tris-based buffer with 6% Trehalose at pH 8.0, which has been optimized for this specific protein . Alternative storage formulations include Tris-based buffer with 50% glycerol .

What reconstitution protocol is recommended for lyophilized ML1177?

The following methodology is recommended for reconstitution:

• Briefly centrifuge the vial prior to opening to bring contents to the bottom

• Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% for long-term storage

• Aliquot to minimize freeze-thaw cycles

• Validate protein activity after reconstitution using appropriate assays

When handling the reconstituted protein, minimize repeated freeze-thaw cycles as they can reduce protein activity and lead to aggregation.

What experimental designs are recommended for determining the function of uncharacterized proteins like ML1177?

When investigating uncharacterized proteins like ML1177, a systematic experimental approach is essential:

• Bioinformatic Analysis Pipeline:

  • Sequence homology comparisons across species

  • Motif identification and structural predictions

  • Phylogenetic analysis to identify potential evolutionary relationships

• Expression and Purification Strategy:

  • Express with different tags (N-terminal His tag is successful for ML1177)

  • Test solubility in various buffer conditions

  • Verify purity by SDS-PAGE (>90% purity has been achieved for ML1177)

• Functional Characterization Methodology:

  • ChIP-exo assay to characterize genome-wide binding sites (effective for uncharacterized transcription factors)

  • RNA-seq for transcript abundance quantification using DESeq2 for differential expression analysis

  • Protein-protein interaction studies through co-immunoprecipitation

• Experimental Design Considerations:

  • Design experiments with clear definitions of factors and responses

  • Use screening designs for multi-factor experiments

  • Apply response surface methodology to find optimal conditions

  • Consider fractional factorial experimental designs for efficiency

This comprehensive approach allows researchers to systematically explore the function of uncharacterized proteins like ML1177, moving from computational predictions to experimental validation.

How can researchers design table-based experiments for studying ML1177 interactions?

When designing table-based experiments for studying ML1177 interactions, researchers should follow these methodological principles:

• Table Design Optimization:

  • Use color and bar encodings for finding maximum values in datasets

  • Implement zebra striping for complex comparison tasks

  • Design tables with clear visual hierarchy to improve data interpretation

• Experimental Design Structure:

  • For first-order models: Consider Hadamard or Plackett and Burman designs

  • For second-order models: Use composite experimental designs or Doehlert uniform shell designs

  • For screening multiple factors: Apply fractional factorial designs (2^k-r)

• Data Collection Framework:

  • Create experimental datasheets with clear factor definitions

  • Document center points and variation steps

  • Include replicates to check reproducibility (experiment 13 in triplicate is recommended)

• Analysis and Visualization Strategy:

  • Generate response surfaces to visualize relationships

  • Calculate coefficients to establish mathematical models

  • Use statistical tools to validate experimental models

Sample experimental table structure for ML1177 interaction studies:

This methodological approach ensures systematic exploration of ML1177 interactions while maximizing information gained from minimal experiments.

What methodological approaches can address challenges in ML1177 structural characterization?

Structural characterization of uncharacterized proteins like ML1177 presents unique challenges that can be addressed through these methodological approaches:

• Molecular Dynamics (MD) Simulation Strategy:

  • Perform multiple MD simulations starting from different initial conditions

  • Calculate center of mass (COM) distributions to identify stable conformations

  • Analyze conformational switches that may affect binding or function

• Cryo-EM Analysis Pipeline:

  • Prepare protein samples with optimal buffer conditions and concentration

  • Collect single-particle data with appropriate detectors and microscopes

  • Process data using software packages like RELION or cryoSPARC

  • Generate 3D reconstructions to reveal structural details

• Methyltransferase Domain Analysis:

  • Focus on specific structural domains if homology to methyltransferases is detected

  • Consider the role of histone modifications in protein function

  • Analyze protein-DNA interactions through binding site identification

• Buffer Optimization Protocol:

  • Test various buffer conditions (Tris-based buffer shows success for ML1177)

  • Evaluate stabilizing agents (trehalose at 6% is effective for ML1177)

  • Determine optimal pH conditions (pH 8.0 has been successful)

By integrating these approaches, researchers can overcome the significant challenges in structurally characterizing uncharacterized proteins like ML1177, potentially leading to functional insights.

How can researchers design experiments to investigate potential roles of ML1177 in bacterial pathogenesis?

When investigating the potential roles of ML1177 in bacterial pathogenesis, researchers should employ these methodological approaches:

• Gene Knockout and Complementation Strategy:

  • Generate ML1177 deletion mutants using Cre/Flox system or CRISPR-Cas9

  • Create complementation strains to verify phenotypes

  • Perform siRNA knockdown experiments for temporary suppression

• Infection Model Design:

  • Select appropriate surrogate models (e.g., similar to MHVA59 for coronavirus studies)

  • Consider both in vitro cell culture systems and in vivo animal models

  • Design time-course experiments to capture dynamic processes

• Transcriptional Regulation Analysis:

  • Apply ChIP-exo assays to characterize genome-wide binding sites

  • Compare relative locations between binding sites and RNA polymerase

  • Classify potential regulatory roles (global regulator, local regulator, single-target regulator)

• Phenotype Assessment Framework:

  • Monitor morphological changes using microscopy techniques

  • Measure expression of relevant markers using RT-PCR

  • Quantify protein expression through Western blotting

  • Assess functional outcomes specific to pathogenesis

By implementing this systematic experimental approach, researchers can effectively investigate the potential roles of ML1177 in bacterial pathogenesis, particularly in the context of Mycobacterium leprae infection dynamics.

What are the most effective methodological approaches for studying potential post-translational modifications of ML1177?

For studying post-translational modifications (PTMs) of ML1177, researchers should consider these methodological approaches:

• Expression System Selection Strategy:

  • For phosphorylation studies: Mammalian or insect cell systems recommended

  • For glycosylation analysis: Consider yeast (for simple glycosylation) or mammalian cells (for complex glycosylation)

  • For minimal modification needs: E. coli expression system is sufficient

• Mass Spectrometry Protocol:

  • Perform tryptic digestion with high-quality proteomics-grade enzymes

  • Use LC-MS/MS with collision-induced dissociation (CID) or electron transfer dissociation (ETD)

  • Apply neutral loss scanning for phosphorylation site mapping

  • Implement multiple reaction monitoring (MRM) for targeted PTM quantification

• PTM-Specific Antibody Approach:

  • Generate antibodies against predicted modification sites

  • Validate antibody specificity using modified and unmodified peptides

  • Apply immunoprecipitation followed by Western blotting to verify modifications

• Bioinformatic Prediction Framework:

  • Use specialized tools to predict potential modification sites

  • Apply machine learning algorithms to improve prediction accuracy

  • Consider evolutionary conservation of predicted modification sites

The combination of these approaches provides a comprehensive strategy for identifying and characterizing potential post-translational modifications of ML1177, which may be critical for understanding its function in Mycobacterium leprae.

What methodological considerations are important when designing experiments to study ML1177 in the context of fetal hemoglobin regulation?

While ML1177 is uncharacterized, researchers interested in hemoglobin regulation pathways could consider these methodological approaches by drawing parallels with MLL1 complex studies:

• Knockdown Experimental Design:

  • Implement knockdowns of target genes using siRNA or CRISPR-Cas9

  • Measure expression of relevant markers (e.g., BCL11A, γ-globin, ε-globin)

  • Quantify cellular responses through appropriate assays

• Binding Site Analysis Protocol:

  • Detect binding at promoter regions and critical enhancers

  • Apply chromatin immunoprecipitation followed by sequencing (ChIP-seq)

  • Analyze data to identify direct transcriptional targets

• Differentiation Assessment Framework:

  • Induce differentiation of CD34+ hematopoietic stem cells

  • Monitor differentiation through cell surface marker expression

  • Quantify production of specific cell types (e.g., F cells)

• Inhibitor Testing Methodology:

  • Evaluate protein-specific inhibitors for effects on target pathways

  • Assess impacts on differentiation with minimal effects on growth

  • Consider timing and dosage optimization for acute vs. long-term effects

Although direct evidence connecting ML1177 to hemoglobin regulation is lacking, these methodological approaches provide a framework for investigating potential regulatory roles of uncharacterized proteins in hematopoietic processes.

How can researchers effectively troubleshoot low yields or insolubility issues when expressing recombinant ML1177?

When troubleshooting expression and solubility issues with recombinant ML1177, researchers should implement this systematic approach:

• Expression System Optimization:

  • Compare yields across multiple systems (E. coli, yeast, insect cells, mammalian cells)

  • Adjust induction conditions (temperature, inducer concentration, duration)

  • Consider codon optimization for the expression host

• Solubility Enhancement Protocol:

  • Test various buffer compositions (Tris-based buffers have been successful)

  • Evaluate solubility additives (glycerol 50% or trehalose 6% show success)

  • Optimize pH conditions (pH 8.0 has been effective)

• Fusion Tag Selection Strategy:

  • N-terminal His-tag has been successful for ML1177

  • Consider solubility-enhancing tags (MBP, SUMO, GST)

  • Evaluate tag removal options if native protein is required

• Refolding Methodology:

  • For inclusion bodies: Implement denaturation with urea or guanidine HCl

  • Design stepwise dialysis protocol to remove denaturants

  • Apply redox systems to facilitate disulfide bond formation

  • Monitor refolding efficiency through activity or structural assays

• Storage and Stability Optimization:

  • Prevent repeated freeze-thaw cycles

  • Store working aliquots at 4°C for short-term use

  • Add stabilizing agents for long-term storage at -20°C or -80°C