Recombinant Uncharacterized protein ML2433 (ML2433)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Please contact us in advance; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ML2433; B2168_C2_209; Uncharacterized protein ML2433
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
full length protein
Species
Mycobacterium leprae (strain TN)
Target Names
ML2433
Target Protein Sequence
MTGPHNDTESPHARPISVAELLARNGTIGAPAVSRRRRRRTDSDAVTVAELTCDIPIIHD DHADEQHLAATHAHRANIGVRVVEPAAQSPLEPVCEGIVAEPPVDDHGHVPPGCWSAPEP RWPKSPPLTHLRTGLQRSACSRPLPHLGDVRHPVAPDSIAQKQSDAEGMSPDPVEPFADI PVDVMGSEVRAAELVAEESAYARYNLQMSAGALFSGHTLTNELAERRGDEHAAGGLLAVG IDLDEDHLDLHTDLAGITSPARGWQSRFEALWRGSLIVLQSILAVVFGAGLFVAFDQLWR WNSIVALVLSVLVILGLVVGVRVVRRTEDIASTLIAVVVGALITLGPLALSLQSG
Uniprot No.

Target Background

Database Links

KEGG: mle:ML2433

STRING: 272631.ML2433

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Uncharacterized Protein ML2433?

Recombinant Uncharacterized Protein ML2433 is a full-length protein (1-355 amino acids) derived from Mycobacterium leprae. It is typically produced in expression systems such as E. coli with a histidine tag to facilitate purification. The protein is considered "uncharacterized" because its precise biological function, three-dimensional structure, and cellular role remain incompletely defined despite its genomic annotation . Methodologically, researchers identify such proteins through genome sequencing and annotation projects, followed by recombinant expression to enable further characterization studies.

Where is ML2433 expressed in Mycobacterium leprae?

While specific expression data for ML2433 is limited in the current literature, researchers typically investigate this question through several approaches: (1) RNA-seq analysis of M. leprae under various growth conditions to detect mRNA expression, (2) proteomics studies using mass spectrometry to identify the protein in different cellular fractions, and (3) immunohistochemistry with antibodies against the recombinant protein to visualize its localization. These methods collectively provide insights into when and where the protein is expressed, which can offer initial clues to its potential function.

What is known about the sequence conservation of ML2433?

Sequence analysis represents a fundamental starting point for understanding uncharacterized proteins. Researchers should perform comprehensive bioinformatic analyses including: multiple sequence alignments with homologs from related mycobacterial species, identification of conserved domains or motifs, and phylogenetic analyses to trace evolutionary relationships. Highly conserved regions often indicate functional importance. From available data, ML2433 appears to be a mycobacterial protein with potential sequence homology to proteins in related species, though detailed conservation analysis is not provided in the current literature .

What structural features might suggest functions for ML2433?

Determining the structure of uncharacterized proteins is critical for function prediction. Researchers should employ a multi-method approach including: (1) in silico structural prediction using tools like AlphaFold2 and I-TASSER, (2) circular dichroism spectroscopy to determine secondary structure content, (3) X-ray crystallography or cryo-EM for high-resolution structural determination, and (4) NMR spectroscopy for dynamic structural information. Comparing predicted structures with known protein folds in databases can suggest potential biochemical functions. For ML2433, researchers might look for potential binding pockets, catalytic sites, or structural similarities to characterized proteins from other organisms.

How can protein-protein interaction studies help characterize ML2433?

Protein-protein interactions often provide valuable clues about function. To investigate potential interacting partners of ML2433, researchers should consider: (1) affinity purification coupled with mass spectrometry (AP-MS) using tagged ML2433 as bait, (2) yeast two-hybrid screening against a M. leprae protein library, (3) proximity labeling methods such as BioID or APEX to identify proteins in close spatial proximity to ML2433 in situ, and (4) co-immunoprecipitation experiments followed by western blot analysis to validate specific interactions. The interactome data obtained can position ML2433 within biological pathways and suggest potential functional roles.

What are the optimal expression and purification strategies for studying ML2433?

For structural and functional studies, obtaining pure, correctly folded ML2433 is essential. Based on available information, ML2433 can be expressed in E. coli as a His-tagged recombinant protein . Researchers should optimize:

  • Expression system selection (bacterial, yeast, baculovirus, or mammalian)

  • Growth conditions (temperature, induction time, media composition)

  • Solubility enhancement (fusion tags, co-expression with chaperones)

  • Purification protocol (affinity chromatography followed by size exclusion)

  • Protein quality assessment (dynamic light scattering, thermal shift assays)

The expression system should be selected based on the specific research question, with E. coli being suitable for initial characterization but potentially other systems needed for more complex studies.

Expression SystemAdvantagesConsiderations for ML2433
E. coli (bacterial)High yield, economical, rapid growthMay lack post-translational modifications, potential inclusion body formation
YeastEukaryotic PTMs, proper protein foldingModerate yield, more complex cultivation
BaculovirusAdvanced PTMs, high-quality proteinHigher cost, longer production time
Mammalian cell linesMost authentic PTMs and foldingHighest cost, lowest yields, longest production time

How should researchers approach contradictory functional predictions for ML2433?

Uncharacterized proteins often generate conflicting predictions through different bioinformatic tools. To resolve these contradictions, researchers should implement a structured approach:

  • Evaluate the confidence scores of each prediction method

  • Prioritize predictions from tools trained on mycobacterial proteins

  • Perform targeted biochemical assays to test each predicted function

  • Use iterative experimental design where results from initial assays inform subsequent experiments

  • Consider that ML2433 might be multifunctional or have context-dependent functions

This systematic evaluation prevents premature function assignment based on low-confidence predictions and builds a more reliable functional profile through empirical validation.

What statistical approaches are recommended for analyzing ML2433 expression data?

When analyzing expression data (transcriptomic or proteomic) involving ML2433, researchers should:

  • Normalize data appropriately for the specific technological platform

  • Apply multiple testing correction for genome-wide analyses

  • Consider both statistical significance (p-values) and biological significance (fold-change)

  • Validate expression patterns using orthogonal methods (e.g., qPCR to validate RNA-seq)

  • Integrate expression data with other omics datasets for a systems biology perspective

For uncharacterized proteins like ML2433, correlating its expression patterns with well-characterized proteins or pathways can provide functional insights through guilt-by-association approaches.

What gene knockout/knockdown strategies are most appropriate for studying ML2433 function?

Understanding the phenotypic consequences of ML2433 absence is crucial for functional characterization. Researchers should consider:

  • CRISPR-Cas9 gene editing to create clean knockouts in model mycobacteria

  • Conditional expression systems to study essential genes

  • CRISPRi for tunable knockdown when complete knockout is lethal

  • Complementation studies to confirm phenotype specificity

  • Comparative phenotypic analysis across multiple growth conditions

When designing such experiments, researchers must account for potential polar effects on nearby genes and validate knockouts/knockdowns at both DNA and protein levels.

How can enzymatic activity be assessed for an uncharacterized protein like ML2433?

Without prior knowledge of function, researchers can implement a systematic approach to identifying potential enzymatic activities:

  • Activity-based protein profiling with broad-spectrum activity probes

  • Metabolite profiling of knockout vs. wild-type strains

  • In vitro screening against substrate libraries

  • Structural analysis to identify potential catalytic residues for targeted mutagenesis

  • Comparative activity assays with predicted orthologous proteins

These approaches cast a wide net to capture potential activities that can then be characterized in greater detail.

What considerations are important when designing antibodies against ML2433 for research applications?

Developing specific antibodies against ML2433 enables numerous applications including western blotting, immunoprecipitation, and immunolocalization. Researchers should:

  • Select antigenic epitopes that are unique to ML2433 (avoiding conserved domains)

  • Consider both polyclonal antibodies (for multiple epitope recognition) and monoclonal antibodies (for consistency)

  • Validate antibody specificity against recombinant ML2433 and cell lysates

  • Test for cross-reactivity with related mycobacterial proteins

  • Optimize fixation and permeabilization conditions for immunolocalization studies

High-quality antibodies are valuable tools that enable tracking of endogenous protein in various experimental contexts.

How can cryo-electron microscopy contribute to understanding ML2433?

Cryo-EM has revolutionized structural biology and offers several advantages for uncharacterized proteins:

  • No requirement for protein crystallization, which can be challenging for novel proteins

  • Ability to visualize multiple conformational states

  • Potential to resolve structures of ML2433 in complex with interaction partners

  • Lower protein quantity requirements compared to some other structural techniques

  • Capability to determine structures at near-atomic resolution

For ML2433, cryo-EM could reveal structural features that provide functional insights, particularly if the protein forms part of a larger complex.

What approaches can identify post-translational modifications of ML2433?

Post-translational modifications (PTMs) can significantly impact protein function. Researchers should employ:

  • Mass spectrometry-based proteomics optimized for PTM detection

  • Western blotting with modification-specific antibodies

  • In vitro modification assays to identify enzymes responsible for ML2433 modifications

  • Site-directed mutagenesis of predicted modification sites to assess functional impact

  • Comparative PTM analysis across different growth conditions

Understanding the PTM landscape of ML2433 may provide crucial insights into its regulation and function within the cell.

How can ML2433 research contribute to understanding Mycobacterium leprae pathogenesis?

While the specific role of ML2433 in M. leprae pathogenesis remains unknown, researchers can explore its potential contributions through:

  • Expression analysis during different stages of infection

  • Localization studies during host-pathogen interaction

  • Immunological studies to assess if ML2433 elicits host immune responses

  • Comparative analysis with homologs in other mycobacterial pathogens

  • Evaluation of ML2433 as a potential diagnostic or vaccine target

These approaches connect basic research on ML2433 to the broader context of leprosy pathogenesis and potential applications in disease management.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.