Recombinant Uncharacterized protein pXO1-111/BXA0163/GBAA_pXO1_0163 (pXO1-111, BXA0163, GBAA_pXO1_0163)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
pXO1-111; BXA0163; GBAA_pXO1_0163; Uncharacterized protein pXO1-111/BXA0163/GBAA_pXO1_0163
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Bacillus anthracis
Target Names
pXO1-111
Target Protein Sequence
MESLGINNIYNALDRIKLNAKMNILVRDPYHYDNNGNIVGVDDSYLKNAYKQILNWSSDG VSLNLDEDVNQALSGYMLQIKKPSNHLTNSPVTITLAGKDSGVGELYRVLSDGTGFLDFN KFDENWRSLVDPGDDVYVYAVTKEDFNAVTRDENGNIANKLKNTLVLSGKIKEINIKTTN INIFVVFMFIIYLLFYIISSTVFAKSCNCILIYVEVSQLMNSVFY
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is protein pXO1-111 and where is it located in the Bacillus anthracis genome?

Protein pXO1-111 (also known as BXA0163 or GBAA_pXO1_0163) is an uncharacterized protein encoded on the pXO1 plasmid of Bacillus anthracis. The pXO1 plasmid is a large circular extrachromosomal element of 181,654 bp that contains a pathogenicity island crucial for B. anthracis virulence. This plasmid has a guanine-plus-cytosine content of 32.5% and encodes 143 open reading frames (ORFs), with pXO1-111 being one of these encoded proteins . The protein appears to be located within the pathogenicity island region, which is defined by a 44.8-kb region bordered by inverted IS1627 elements. The pathogenicity island contains various virulence factors including the three main anthrax toxin genes (cya, lef, and pagA), regulatory elements, and germination response genes . The positioning of pXO1-111 within this region suggests potential involvement in virulence, though its precise function remains to be elucidated.

How does pXO1-111 relate to the pathogenicity mechanisms of B. anthracis?

While the exact function of pXO1-111 remains uncharacterized, its location on the pXO1 plasmid places it in proximity to established virulence factors. The pXO1 plasmid contains the genes encoding the three components of anthrax toxin: protective antigen (pagA), lethal factor (lef), and edema factor (cya) . The plasmid also contains regulatory elements controlling toxin gene expression, such as atxA, which is a global regulator of virulence gene expression. Based on its genomic context, pXO1-111 could potentially function in virulence regulation, similar to characterized proteins like PagR1 and PagR2, which control expression of pagA, sap, and eag genes . Alternatively, it might participate in other aspects of B. anthracis pathogenesis, such as germination, growth in host environments, or interaction with host factors. The gene was originally identified during the cloning and sequencing of the pagA and atxA genes, suggesting potential functional or regulatory relationships with these critical virulence determinants .

What expression systems are optimal for recombinant production of pXO1-111?

Based on available commercial production methods, E. coli has been successfully employed as an expression host for recombinant pXO1-111 . For laboratory-scale expression, several factors should be considered when selecting an optimal system. The BL21(DE3) E. coli strain or its derivatives would be appropriate starting points due to their reduced protease activity and strong expression from T7 promoters. For complex proteins, especially those with potential membrane association like pXO1-111 (given its hydrophobic C-terminus), specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression might be beneficial. Expression vectors combining an N-terminal His-tag (as used in commercial preparations) with additional solubility enhancers such as SUMO, MBP, or Trx tags could improve protein solubility and yield.

The expression protocol should evaluate multiple induction temperatures (15-37°C), IPTG concentrations (0.1-1.0 mM), and induction times (3-24 hours) to optimize yield and solubility. For this specific protein, lower induction temperatures (15-25°C) might prevent aggregation of the hydrophobic regions. If E. coli expression proves challenging, alternative expression systems such as Bacillus subtilis (more closely related to the native organism), Pichia pastoris (for potential glycosylated forms), or cell-free expression systems could be explored. Expression trials should be monitored by SDS-PAGE and Western blotting, with systematic optimization of each parameter.

How might pXO1-111 interact with known virulence regulators on the pXO1 plasmid?

The pXO1 plasmid contains several regulatory proteins that orchestrate B. anthracis virulence, including AtxA and the PagR paralogs. PagR1 and PagR2 have been shown to regulate multiple virulence genes, including pagA, sap, and eag, through DNA binding and possibly protein-protein interactions . Given its location within the pathogenicity island, pXO1-111 could potentially interact with these regulatory networks through several mechanisms. It might function as a co-regulator with established transcription factors like AtxA or PagR proteins, modulating their binding to target promoters or their activity once bound. This hypothesis could be tested using co-immunoprecipitation experiments with tagged versions of pXO1-111 and known regulators.

Pull-down assays followed by mass spectrometry analysis would identify potential protein binding partners. Additionally, chromatin immunoprecipitation (ChIP) experiments could determine if pXO1-111 associates with DNA regions regulated by other virulence factors. Bacterial two-hybrid or yeast two-hybrid screening would provide another approach to identify interaction partners. Experimental designs should include appropriate controls such as a non-pathogenic Bacillus strain expressing tagged pXO1-111, comparison with tagged irrelevant proteins, and validation of interactions through multiple methodologies. Particular attention should be paid to potential interactions with PagR1 and PagR2, as these paralogs show distinct DNA-binding properties despite high sequence similarity .

What analytical techniques are most effective for functional characterization of uncharacterized proteins like pXO1-111?

A comprehensive functional characterization strategy for pXO1-111 should employ multiple complementary approaches. Comparative genomics analysis should first examine conservation and synteny of pXO1-111 across Bacillus species and related bacterial genomes to provide evolutionary context. Transcriptomics (RNA-seq) and proteomics analyses comparing wildtype B. anthracis to pXO1-111 deletion mutants would reveal potential genes and pathways affected by this protein. For structural insights, X-ray crystallography or cryo-EM could determine the three-dimensional structure, while NMR spectroscopy might identify dynamic regions or binding interfaces.

Functional genomics approaches including transposon mutagenesis coupled with fitness assays under various stress conditions could illuminate cellular processes requiring pXO1-111. Biochemical techniques such as electrophoretic mobility shift assays (EMSAs) should test potential DNA-binding activity, given that many pathogenicity island proteins like PagR1 and PagR2 bind DNA to regulate gene expression . In vitro enzyme activity assays with various substrates (nucleic acids, proteins, small molecules) could uncover catalytic functions. Immunolocalization experiments would determine subcellular localization, which might suggest function based on compartmentalization. Additionally, heterologous expression of pXO1-111 in model organisms like B. subtilis followed by phenotypic analysis could reveal functional insights when combined with controlled expression systems and reporter fusions.

What site-directed mutagenesis strategies would be most informative for functional domain mapping of pXO1-111?

A systematic mutagenesis approach would be crucial for dissecting functional domains within pXO1-111. Based on sequence analysis and predicted structural features, several targeting strategies are recommended. First, alanine-scanning mutagenesis of conserved residues or predicted functional motifs would identify amino acids critical for function. The hydrophobic C-terminal region (approximately residues 180-225) should be targeted for deletion or substitution to test its role in membrane association or protein-protein interactions. Charged residues often participate in molecular interactions, so clusters of charged amino acids should be systematically mutated.

Serial truncation mutants from both N- and C-termini would define minimal functional regions. The study of PagR proteins revealed that a single amino acid difference at residue 81 (tyrosine in PagR1 vs. serine in PagR2) significantly affected DNA-binding ability . This highlights how single amino acid substitutions can dramatically alter function. Similar critical residues in pXO1-111 might be identified through targeted mutagenesis of conserved or predicted functional sites. Each mutant construct should be evaluated in both in vitro assays (protein stability, binding properties) and in vivo functional complementation assays in a pXO1-111 deletion background. Structural modeling based on related proteins, even with limited homology, could guide additional mutation targets, particularly for residues predicted to be surface-exposed versus buried in the protein core.

How does the expression of pXO1-111 potentially change under different conditions that affect B. anthracis virulence?

Understanding the expression pattern of pXO1-111 under varying environmental conditions would provide valuable insights into its function. A comprehensive expression analysis should include quantitative RT-PCR and/or Western blot analysis across multiple growth phases and environmental conditions. Key conditions to test include: growth in rich media (BHI) versus minimal media; aerobic versus CO2-rich (5-10%) atmospheres that stimulate toxin production; varying temperatures (25°C, 37°C, 42°C) to simulate environmental versus mammalian host conditions; and exposure to host-relevant stimuli such as serum, macrophage lysates, or defined host factors.

The expression of many pXO1-encoded virulence factors is controlled by regulatory elements that respond to specific environmental cues. For instance, PagR proteins have been studied in toxin-inducing conditions (CA-CO2 at 37°C), with expression induction at specific growth phases (early exponential phase, OD600 = 0.2-0.3) . Similar experimental designs should be applied to pXO1-111, with particular attention to correlation between its expression and that of established virulence factors. The analysis should also include examination of pXO1-111 expression in regulatory mutant backgrounds (ΔatxA, ΔpagR1) to establish potential regulatory relationships. Reporter gene fusions (e.g., pXO1-111 promoter driving luciferase or GFP expression) would allow real-time monitoring of expression dynamics under varying conditions and in different genetic backgrounds.

What purification strategies are recommended for His-tagged pXO1-111 protein?

Purification of His-tagged pXO1-111 requires a carefully optimized protocol considering the protein's characteristics. Based on the commercial preparation and standard approaches for His-tagged proteins, the following strategy is recommended. After expression in E. coli, cells should be harvested by centrifugation and lysed using either sonication or high-pressure homogenization in a buffer containing 20-50 mM Tris-HCl (pH 8.0), 300-500 mM NaCl, 5-10% glycerol, and protease inhibitors. Given the potential membrane association of pXO1-111 due to its hydrophobic C-terminus, inclusion of 0.5-1% non-ionic detergent (Triton X-100 or n-dodecyl-β-D-maltoside) during lysis may improve solubilization.

The initial purification step should employ immobilized metal affinity chromatography (IMAC) using Ni-NTA or cobalt-based resins with an imidazole gradient elution (20-300 mM). Size exclusion chromatography as a second step would separate aggregates, monomers, and potential oligomeric states while simultaneously performing buffer exchange. For applications requiring higher purity, ion exchange chromatography could be included as an intermediate step based on the protein's predicted isoelectric point. Throughout purification, protein fractions should be analyzed by SDS-PAGE and Western blotting with anti-His antibodies. The final purified protein should be characterized by mass spectrometry to confirm identity and detect any post-translational modifications. For storage, the addition of 5-50% glycerol is recommended to prevent freeze-thaw damage, with 50% being optimal for long-term storage at -20°C/-80°C .

How can researchers assess the stability and solubility of recombinant pXO1-111?

A comprehensive assessment of pXO1-111 stability and solubility should employ multiple complementary methods. Initially, the protein's theoretical properties should be calculated using bioinformatics tools to predict isoelectric point, hydrophobicity profile, and aggregation propensity. For experimental evaluation, differential scanning fluorimetry (thermofluor assay) provides a high-throughput method to assess thermal stability across different buffer conditions (varying pH, salt concentration, additives). This would establish optimal buffer conditions for maintaining protein stability. Dynamic light scattering would monitor aggregation state and homogeneity in solution over time and under different storage conditions.

What functional assays could be developed to determine the role of pXO1-111 in B. anthracis virulence?

To comprehensively characterize the function of pXO1-111 in B. anthracis virulence, a multi-faceted approach combining genetic, biochemical, and infection models is necessary. Gene deletion and complementation studies should establish the impact of pXO1-111 on virulence factor expression by measuring transcription and protein levels of known virulence factors (protective antigen, lethal factor, edema factor) in wildtype versus Δpxo1-111 strains. Quantitative RT-PCR assays similar to those used for studying PagR proteins could measure transcript levels of pagA, atxA, sap, and eag genes in the presence and absence of pXO1-111 . Reporter gene fusions (luciferase or fluorescent proteins) to virulence gene promoters would allow real-time monitoring of expression patterns.

Biochemical assays should include testing for DNA-binding activity using electrophoretic mobility shift assays (EMSAs) with promoter regions of virulence genes, as performed with PagR proteins . Protein-protein interaction assays (co-immunoprecipitation, pull-downs, surface plasmon resonance) could identify binding partners among known virulence regulators. Cell culture infection models using macrophages or epithelial cells would assess the impact of pXO1-111 deletion on adherence, invasion, intracellular survival, and cytotoxicity. For organisms with appropriate biocontainment facilities, animal infection models using attenuated strains with and without pXO1-111 would provide in vivo relevance. Additionally, competitive growth assays under various stress conditions (oxidative stress, nutrient limitation, antimicrobial peptides) might reveal condition-specific functions relevant to host-pathogen interactions.

What are the optimal storage conditions for maintaining the activity of purified pXO1-111?

Based on recommended storage conditions for the commercial preparation and general principles for protein storage, several approaches should be considered for maintaining pXO1-111 stability and activity. The purified protein should be stored in a buffer containing 20-50 mM Tris or phosphate buffer (pH 7.5-8.0) with 100-300 mM NaCl to maintain ionic strength. The addition of glycerol at 5-50% is critical as a cryoprotectant, with a final concentration of 50% recommended for optimal long-term storage at -20°C or -80°C . For proteins with hydrophobic regions like pXO1-111, the addition of non-ionic detergents at concentrations above their critical micelle concentration may help maintain solubility.

The protein should be aliquoted into small volumes before freezing to avoid repeated freeze-thaw cycles, which can significantly reduce activity. For working solutions, storage at 4°C is suitable for up to one week . Lyophilization (freeze-drying) represents another storage option that eliminates the need for freezers and facilitates shipping; the commercial preparation is available as a lyophilized powder . When reconstituting lyophilized protein, a brief centrifugation is recommended to bring contents to the bottom of the vial, followed by addition of sterile deionized water to achieve a concentration of 0.1-1.0 mg/mL . Stability studies should monitor protein integrity over time using SDS-PAGE, Western blotting, and functional assays to establish the effective shelf-life under different storage conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.