Recombinant Uncharacterized protein pXO2-05/BXB0004/GBAA_pXO2_0004 (pXO2-05, BXB0004, GBAA_pXO2_0004)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. To request a specific tag type, please inform us in advance, and we will prioritize its development.
Synonyms
pXO2-05; BXB0004; GBAA_pXO2_0004; Uncharacterized protein pXO2-05/BXB0004/GBAA_pXO2_0004
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-282
Protein Length
full length protein
Species
Bacillus anthracis
Target Names
pXO2-05
Target Protein Sequence
MSIKFWMNKEGRKPANTKRKAYLFTLGSFVTMFFVLCISPVFSGATYKFEEMKIGEYQSL SSTVKIAVAKKEYNPDNQTLRIDYELRADNDSQILSNMKYKVENKYIKQKDNNVKTKVYR ASDNYIVVISENVPEEFGVVSSVVKPEYIHPELQNDVDDLKERSMKMYVLENEKLINREL KKKSKDFYEREYLAFSQQALRKEIEKKMEDKSSAMKQLKIKNEQLTKEMEYQTEGEKVKT KNTINSNESTINNHQKEIDVLKEDIKMKEKKIQLLDEKKKTI
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What are the optimal conditions for handling recombinant pXO2-05/BXB0004/GBAA_pXO2_0004 protein in laboratory settings?

For researchers working with the recombinant form of this protein, the following handling and storage protocols are recommended :

ParameterRecommended Condition
Storage temperature-20°C/-80°C
Working storage4°C for up to one week
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Long-term preservationAdd 5-50% glycerol (final concentration)
Stability considerationAvoid repeated freeze-thaw cycles

When expressing recombinant pXO2-05, researchers have successfully used E. coli expression systems with an N-terminal His-tag for purification purposes. The protein is typically supplied in lyophilized form with purity greater than 90% as determined by SDS-PAGE .

How does the pXO2 plasmid contribute to Bacillus anthracis virulence?

The pXO2 plasmid is one of two major virulence-associated plasmids in Bacillus anthracis, the other being pXO1. While pXO1 primarily encodes toxin components (protective antigen, lethal factor, and edema factor), pXO2 encodes the genes responsible for capsule synthesis . The capsule allows the bacterium to evade host immune defenses, particularly phagocytosis, enabling bacterial proliferation within the host.

Recent research has revealed that the relationship between these plasmids is more complex than previously thought. The pXO2 plasmid contains regulatory elements that influence gene expression on pXO1, creating an intricate virulence regulation network . For example, the pagR gene on pXO2 (pagR-XO2) has been shown to positively regulate toxin gene expression on pXO1, demonstrating inter-plasmid communication that fine-tunes virulence factor production.

How does the pagR gene on pXO2 influence the regulation of virulence factors encoded on pXO1?

Research has uncovered a sophisticated regulatory relationship between the pagR genes located on the pXO1 and pXO2 plasmids in Bacillus anthracis. The study by Liang et al. demonstrated that a 5 bp deletion in the promoter region of the pagR gene on pXO2 (pagR-XO2) results in silencing of this gene's expression, which subsequently affects toxin production .

Through gene replacement experiments using homologous recombination, researchers created strain Pasteur IV, which had the wild-type pagR-XO2 promoter sequence restored. Quantitative PCR analysis revealed the following changes in gene expression compared to the Pasteur II strain with the deletion :

GeneExpression in Pasteur IV vs. Pasteur II
pagA8-fold higher
lef8-fold higher
pagR-XO28-fold higher
SlayA8-fold higher
atxA8-fold higher

These findings reveal that pagR-XO2 positively regulates virulence gene expression on pXO1. Interestingly, this contradicts the known function of pagR-XO1 (located on pXO1), which acts as a repressor of pagA. This suggests an antagonistic relationship between these homologous regulators, where pagR-XO2 may function to counterbalance the repressive effects of pagR-XO1, maintaining optimal levels of toxin production .

The mechanism likely involves pagR-XO2 negatively regulating the expression of pagR-XO1, thereby relieving repression of toxin genes. This complex cross-talk between the two plasmids demonstrates how Bacillus anthracis has evolved sophisticated regulatory networks to control virulence factor production.

What experimental approaches are most effective for characterizing the function of uncharacterized pXO2-05/BXB0004/GBAA_pXO2_0004?

Based on successful approaches used to study other pXO2-encoded proteins, a comprehensive experimental strategy for characterizing pXO2-05 would include:

  • Gene deletion and complementation studies:

    • Generate a ΔpXO2-05 mutant using allelic exchange

    • Complement the mutation with the wild-type gene under native or inducible promoters

    • Assess phenotypic changes in virulence, capsule formation, and stress resistance

  • Transcriptomic and proteomic analyses:

    • Perform RNA-seq to identify genes differentially expressed in the deletion mutant

    • Use quantitative RT-PCR to validate expression changes of candidate genes

    • Apply LC-MS/MS proteomics to identify protein interaction partners

  • Protein localization and interaction studies:

    • Generate fluorescent protein fusions to determine subcellular localization

    • Perform co-immunoprecipitation experiments to identify protein binding partners

    • Use bacterial two-hybrid or pull-down assays to validate direct interactions

  • Structural biology approaches:

    • Express and purify recombinant protein for crystallization trials

    • Use X-ray crystallography or cryo-EM to determine three-dimensional structure

    • Perform molecular dynamics simulations to predict functional domains

  • Animal infection models:

    • Compare virulence of wild-type and ΔpXO2-05 strains in appropriate animal models

    • Assess bacterial load, dissemination, and host immune responses

    • Test for protective immunity using recombinant protein as a vaccine candidate

The combination of these approaches would provide comprehensive insights into the function of pXO2-05 in Bacillus anthracis biology and pathogenesis.

How does the evolutionary diversity of pXO2 plasmids across the Bacillus cereus group affect the conservation and function of pXO2-05?

The pXO2 plasmid shows significant diversity across members of the Bacillus cereus group, which includes Bacillus anthracis, Bacillus cereus, and Bacillus thuringiensis. Studies have identified pXO2-like plasmids in various species within this group, suggesting horizontal transfer and evolutionary diversification .

Analysis of pXO2-like plasmids has revealed:

  • Variations in the presence of transfer modules (tra regions), with 17 of 22 pXO2-like plasmids containing functional transfer systems capable of self-transfer and mobilization of smaller plasmids

  • Differences in the presence of group II introns B.th.I.1 and B.th.I.2, suggesting flexibility in conjugation modules and their regulation

  • Discrepancies between pXO2-like repA and virB4 dendrograms, indicating that the evolution of pXO2 is an active and ongoing process

For pXO2-05 specifically, this evolutionary diversity raises several important research questions:

  • Is pXO2-05 conserved across different pXO2-like plasmids, suggesting a core function?

  • How does sequence variation in pXO2-05 homologs correlate with differences in virulence or host specificity?

  • Has pXO2-05 undergone functional diversification in different bacterial species?

  • Could pXO2-05 homologs from less virulent species serve as attenuated antigens for vaccine development?

Comparative genomic and functional analyses of pXO2-05 across the Bacillus cereus group could provide valuable insights into its evolutionary history and functional significance in bacterial pathogenesis.

What are the challenges in distinguishing the functions of pXO2-05 from other proteins encoded on the pXO2 plasmid?

Characterizing the specific functions of pXO2-05 presents several methodological challenges:

  • Functional redundancy: The pXO2 plasmid encodes multiple proteins that may have overlapping or complementary functions. For example, the pagR paralogs on pXO1 and pXO2 show 70% amino acid sequence identity but have distinct and sometimes opposing regulatory effects . This functional redundancy can mask phenotypes in single-gene deletion studies.

  • Regulatory networks: The complex regulatory interactions between genes on pXO1 and pXO2 make it difficult to isolate the effects of individual proteins. For instance, the pagR gene on pXO2 influences expression of genes on pXO1, including pagA, lef, and atxA . Similarly, pXO2-05 may participate in regulatory networks that extend beyond the pXO2 plasmid.

  • Context-dependent function: The function of pXO2-05 may be context-dependent, only becoming apparent under specific environmental conditions or during particular stages of infection. This necessitates testing multiple conditions to reveal its role.

  • Technical limitations: Working with fully virulent Bacillus anthracis requires specialized containment facilities. Many studies use attenuated strains or heterologous expression systems, which may not fully recapitulate the native function of pXO2-05.

To overcome these challenges, researchers should consider:

  • Using combinatorial gene deletions to address functional redundancy

  • Applying systems biology approaches to map regulatory networks comprehensively

  • Testing function under diverse environmental conditions that mimic different stages of infection

  • Developing improved model systems that better reflect the native context while maintaining biosafety

Understanding these challenges is essential for designing experiments that can effectively elucidate the specific functions of pXO2-05 amid the complex background of other pXO2-encoded virulence factors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.