Recombinant Uncharacterized protein pXO2-11/BXB0010/GBAA_pXO2_0010 (pXO2-11, BXB0010, GBAA_pXO2_0010)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

The protein is produced through recombinant DNA technology with the following specifications:

PropertyDetail
UniProt IDQ9RN21
Gene LocuspXO2 plasmid: pXO2-11, BXB0010, GBAA_pXO2_0010
Amino Acid SequenceMEMMRNPKNTKQEIKLAFFYIIDGAIIALMLVLASYMPKVVPVGGFGRIMFYVLFGTFGLFLCIKPHNSPTNRNIFVILDMLKMDNKNYHPIEVNTISSETKRK
Expression SystemEscherichia coli
Storage Conditions-20°C in Tris-based buffer with 50% glycerol

Research Applications

This recombinant protein is primarily utilized in:

  • Immunoassay Development: Commercial ELISA kits for anthrax research

  • Pathogenicity Studies: Investigating pXO2-pXO1 plasmid crosstalk

  • Structural Biology: Template for membrane protein crystallization trials

Recent studies using pXO2-11 analogs demonstrate:

  1. 72% sequence homology with PagR2 regulatory proteins

  2. Potential metal-binding domains characteristic of ArsR-family regulators

  3. Upregulation under low-iron conditions (simulating host environments)

Emerging Research Directions

Current investigations focus on:

  • CRISPR-interference studies to elucidate transcriptional regulation pathways

  • Yeast two-hybrid screening for interaction partners

  • Structural modeling of putative DNA-binding domains

  • Comparative analysis with Sterne strain variants

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
pXO2-11; BXB0010; GBAA_pXO2_0010; Uncharacterized protein pXO2-11/BXB0010/GBAA_pXO2_0010
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Bacillus anthracis
Target Names
pXO2-11
Target Protein Sequence
MEMMRNPKNTKQEIKLAFFYIIDGAIIALMLVLASYMPKVVPVGGFGRIMFYVLFGTFGL FLCIKPHNSPTNRNIFVILDMLKMDNKNYHPIEVNTISSETKRK
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is protein pXO2-11 and where is it located in the bacterial genome?

Protein pXO2-11 (also referred to as BXB0010 or GBAA_pXO2_0010) is an uncharacterized protein encoded by one of the 85 open reading frames (ORFs) present on the 96.2 kb Bacillus anthracis plasmid pXO2 . The pXO2 plasmid is critical for B. anthracis virulence, as it encodes the capsule genes (dep, capACB, acpA) essential for causing anthrax disease . The protein is plasmid-encoded rather than chromosomally encoded, making it part of the accessory genome rather than the core genome of B. anthracis.

Why is the pXO2 plasmid significant in Bacillus anthracis research?

The pXO2 plasmid is one of two virulence plasmids in B. anthracis and is required for the bacterium to cause anthrax . Complete sequencing and annotation of pXO2 has identified 85 ORFs, though relatively little is known about the identity and function of most pXO2 ORFs beyond the established virulence genes associated with the B. anthracis capsule . Research into proteins like pXO2-11 is valuable because understanding the function of these uncharacterized ORFs may provide insights into the pathogenicity mechanisms of B. anthracis and potentially reveal new targets for therapeutic intervention.

Are sequences similar to pXO2-11 found in other bacterial species?

Based on comparative genomic studies, some pXO2 ORFs have been found to be conserved in other closely related Bacillus species, particularly in B. cereus and B. thuringiensis isolates . Research has shown that B. thuringiensis isolates 33679 and AWO6 contain the greatest number of sequences similar to pXO2 ORFs; with 10 detected in 33679 and 16 in AWO6 . The specific conservation status of pXO2-11 would require targeted PCR and hybridization studies similar to those conducted for other pXO2 ORFs. The presence of pXO2 sequences in other Bacillus isolates does not correlate with genomic relatedness established by Amplified Fragment Length Polymorphism (AFLP) analysis .

What expression systems are recommended for producing recombinant pXO2-11 protein?

For expression of recombinant pXO2-11, the Pichia pastoris expression system is highly recommended as it is one of the most successful and popular eukaryotic expression systems for recombinant proteins . This system offers several advantages for expressing potentially complex bacterial proteins like pXO2-11:

  • Proper protein folding capabilities

  • Appropriate post-translational modifications

  • Correct glycosylation at specific sites, which contributes to protein stability

  • High yield production compared to mammalian systems

  • Less expensive nutrient requirements than mammalian systems

When working with pXO2-11, using engineered P. pastoris strains such as SuperMan5, which expresses target proteins with a mannose-5 structure at N-linked sites, may be particularly beneficial if the protein requires glycosylation for proper function or stability .

What are the methodological challenges in expressing and purifying pXO2-11?

Several methodological challenges may be encountered when working with pXO2-11:

  • Transformation efficiency: Unlike bacterial systems, P. pastoris transformation requires large amounts (μg-level) of plasmid DNA, which can be limiting .

  • Protein characterization: As an uncharacterized protein, optimal expression conditions may need to be determined empirically through systematic testing of:

    • Induction conditions

    • Temperature

    • pH

    • Media composition

    • Harvest timing

  • Purification strategy selection: Without known functional domains or characteristics, initial purification approaches may need to rely on affinity tags and subsequently be optimized based on experimental results.

  • Functional assessment: Designing appropriate assays to determine function will be challenging without prior knowledge of the protein's role.

How should experiments be designed to characterize the function of pXO2-11?

When designing experiments to characterize pXO2-11, a structured approach using experimental design principles is essential . The following methodology is recommended:

  • Define clear variables:

    • Independent variables: Expression conditions, purification methods, interaction partners

    • Dependent variables: Protein activity, binding affinity, structural characteristics

  • Control for extraneous variables: Ensure experimental conditions minimize confounding factors that could affect protein characterization results .

  • Implement parallel approaches:

    • Structural analysis (X-ray crystallography, NMR, cryo-EM)

    • Functional assays (enzyme activity tests, protein-protein interaction studies)

    • In silico analysis (homology modeling, molecular dynamics)

    • Comparative genomics with related Bacillus species

  • Randomization: When testing multiple conditions, randomize experiments to minimize systematic errors and biases .

  • Develop a sequential investigation plan:

    PhaseObjectiveMethodsExpected Outcome
    1Expression optimizationTest multiple expression systems including P. pastoris Identify optimal system for high-quality protein yield
    2Initial characterizationBiochemical assays, mass spectrometry, circular dichroismBasic structural and biochemical properties
    3Interaction studiesPull-down assays, yeast two-hybrid, co-immunoprecipitationPotential binding partners
    4Functional analysisGene knockout/complementation in B. anthracisPhenotypic effects of protein absence/presence

What controls should be included when studying pXO2-11 conservation across Bacillus species?

When studying the conservation of pXO2-11 across different Bacillus species, the following controls and methodological considerations are essential:

  • Positive controls: Include genomic DNA from B. anthracis strains known to contain the pXO2 plasmid .

  • Negative controls: Use DNA from B. anthracis strains cured of the pXO2 plasmid to confirm specificity .

  • Phylogenetic sampling strategy: Select Bacillus isolates with varying degrees of genomic relatedness to B. anthracis as determined by AFLP analysis to test whether sequence conservation correlates with phylogenetic relatedness .

  • Multiple detection methods: Employ both PCR and DNA hybridization techniques, as used in previous pXO2 ORF conservation studies . The table below summarizes an approach similar to what has been used for other pXO2 ORFs:

    Bacillus IsolateGenomic Relatedness to B. anthracis (Jaccard distance)PCR DetectionHybridization Detection
    B. thuringiensis AWO6[Value would be determined]Yes/NoYes/No
    B. thuringiensis 33679[Value would be determined]Yes/NoYes/No
    [Other isolates][Values would be determined]Yes/NoYes/No
  • Sequence confirmation: All PCR products should be sequenced to confirm identity and calculate sequence similarity percentages to the original pXO2-11 .

How can computational approaches assist in predicting the function of pXO2-11?

For uncharacterized proteins like pXO2-11, computational approaches offer valuable tools for initial functional predictions:

  • Homology modeling: Generate structural models based on proteins with similar sequences, even with low sequence identity (20-30%).

  • Domain prediction: Identify conserved domains that might suggest function using tools like PFAM, PROSITE, or InterPro.

  • Phylogenetic profiling: Analyze the co-occurrence patterns of pXO2-11 with other genes across species to infer potential functional associations.

  • Protein-protein interaction prediction: Use algorithms that predict potential interaction partners based on sequence features, which may suggest functional pathways.

  • Subcellular localization prediction: Computational tools can predict where the protein might be located in the cell, providing clues to its function.

The methodological approach should involve multiple algorithms and tools to generate consensus predictions, followed by experimental validation of the most promising hypotheses.

What role might pXO2-11 play in horizontal gene transfer between Bacillus species?

The conservation of pXO2 sequences in different Bacillus species raises important questions about horizontal gene transfer (HGT). To investigate whether pXO2-11 plays a role in HGT:

  • Analyze sequence features: Examine pXO2-11 and its flanking regions for signatures of mobile genetic elements, including:

    • Transposase recognition sites

    • Insertion sequences

    • Inverted repeats

    • Anomalous GC content

  • Comparative genomics approach: Compare the genetic context of pXO2-11 homologs in different species to identify synteny or rearrangements indicative of HGT events .

  • Experimental methodology:

    • Conjugation experiments between B. anthracis and other Bacillus species

    • Transformation studies to assess transferability of the region containing pXO2-11

    • Creation of reporter constructs to track potential mobility of the genetic element

  • Structural analysis: Determine if pXO2-11 shares structural features with proteins known to be involved in conjugation or other HGT mechanisms.

Based on previous studies of pXO2, horizontal plasmid transfer among bacteria, including isolates of the B. cereus/thuringiensis group has been documented . Investigation of whether pXO2-11 specifically facilitates this process would require targeted genetic experiments.

How do you design experiments to determine if pXO2-11 interacts with virulence mechanisms?

To investigate potential interactions between pXO2-11 and virulence mechanisms:

How can researchers address protein insolubility issues when working with recombinant pXO2-11?

When encountering insolubility issues with recombinant pXO2-11:

  • Optimize expression conditions:

    • Test different temperatures (15°C, 20°C, 25°C, 30°C)

    • Vary induction parameters (concentration, timing, duration)

    • Try different media formulations

  • Modify protein constructs:

    • Create truncated versions to remove potentially insoluble domains

    • Use solubility-enhancing fusion partners (MBP, SUMO, thioredoxin)

    • Optimize codon usage for the expression host

  • Adjust purification approach:

    • Include stabilizing additives in buffers (glycerol, arginine, detergents)

    • Test different pH conditions and salt concentrations

    • Consider mild denaturing conditions followed by refolding

  • Leverage the advantages of P. pastoris:

    • This expression system can provide proper protein folding and post-translational modifications that may be critical for solubility

    • Engineer strains like SuperMan5 can produce specific glycosylation patterns that may enhance solubility

  • Consider structural biology predictions:

    • Use in silico analysis to identify and modify aggregation-prone regions

    • Introduce strategic mutations to enhance solubility without affecting function

What are the best practices for resolving contradictory results in pXO2-11 functional studies?

When faced with contradictory results in functional studies of pXO2-11:

  • Systematic review of experimental variables:

    • Create a comprehensive table documenting all experimental conditions across contradictory studies

    • Identify subtle differences in protocols that might explain discrepancies

  • Independent verification with multiple techniques:

    • Confirm key findings using complementary methodologies

    • When two techniques give contradictory results, introduce a third orthogonal approach

  • Control for strain-specific effects:

    • Test hypotheses in multiple B. anthracis strains

    • Consider genetic background effects by introducing the same genetic modifications into different strains

  • Address biological variability:

    • Increase the number of biological replicates

    • Use statistical approaches appropriate for the data distribution

    • Consider Bayesian approaches for integrating conflicting data sets

  • Experimental design review:

    • Ensure proper randomization to prevent systematic bias

    • Verify that controls adequately account for all variables

    • Consider blinded analysis of results where appropriate

  • Collaborative cross-validation:

    • Establish collaborations with independent laboratories to reproduce key findings

    • Share detailed protocols and reagents to ensure methodological consistency

What emerging technologies could advance our understanding of pXO2-11 function?

Several cutting-edge technologies hold promise for elucidating the function of pXO2-11:

  • CRISPR-Cas9 applications:

    • Precise genome editing to create subtle mutations in pXO2-11

    • CRISPRi for tunable repression to study dosage effects

    • CRISPR screening to identify genetic interactions

  • Structural biology advances:

    • Cryo-electron microscopy for determining protein structure without crystallization

    • Hydrogen-deuterium exchange mass spectrometry to map protein interactions

    • Integrative structural biology combining multiple data sources

  • Single-cell approaches:

    • Single-cell RNA-seq to detect cell-to-cell variability in response to pXO2-11 manipulation

    • Single-cell proteomics to track protein-level changes

    • Microfluidic systems to monitor individual bacterial responses

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis to position pXO2-11 within cellular pathways

    • Mathematical modeling of potential regulatory networks

  • Advanced imaging techniques:

    • Super-resolution microscopy to track protein localization

    • Live-cell imaging with fluorescent tags to monitor dynamics

    • Correlative light and electron microscopy for structural context

How might comparative studies across Bacillus species inform evolutionary understanding of pXO2-11?

Comparative evolutionary studies of pXO2-11 across Bacillus species can provide valuable insights:

  • Phylogenetic analysis methodologies:

    • Construct maximum likelihood trees of pXO2-11 homologs

    • Compare gene trees with species trees to identify horizontal gene transfer events

    • Calculate selection pressures (dN/dS ratios) to identify conservation patterns

  • Genomic context comparisons:

    • Analyze synteny conservation across species

    • Identify co-evolving gene clusters

    • Map structural variations in the genomic neighborhood

  • Experimental approaches:

    • Heterologous expression studies to test functional conservation

    • Complementation experiments across species

    • Domain swapping to identify functionally critical regions

  • Ecological contextualization:

    • Correlate presence/absence of pXO2-11 homologs with ecological niches

    • Investigate whether environmental factors drive conservation

    • Study distribution in environmental versus clinical isolates

  • Ancestral sequence reconstruction:

    • Infer ancestral sequences of pXO2-11

    • Express reconstructed proteins to test functional hypotheses

    • Model evolutionary trajectories based on sequence changes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.