Recombinant Uncharacterized protein pXO2-22/BXB0021/GBAA_pXO2_0021 (pXO2-22, BXB0021, GBAA_pXO2_0021)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted upon request.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, specific tag requests should be communicated to ensure preferential development.
Synonyms
pXO2-22; BXB0021; GBAA_pXO2_0021; Uncharacterized protein pXO2-22/BXB0021/GBAA_pXO2_0021
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Bacillus anthracis
Target Names
pXO2-22
Target Protein Sequence
MRVVTAKSIKKNRYNRMFAEEDLYSMLEEMGNTQQMINKFQKKRITQTILLSFFGLLLGL FFTSWCYLLALGLPFFFYRSKYTHVTKTYNAFKFERHLNFSKFTRLLIPYLKESGESTSL YQVFRKILNRMDNPVDKNSLAKLMSEMTDKPNDIQPFTDYAMRSSGSDMSINIMQTIYDF QQNSSDTNVINELGQMASAELQRAIDEIIAFKLRRFNFFPTKIVMSSFILVVGFAAAVLV HHLSSINLS
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant pXO2-22 protein?

For research purposes, E. coli represents the most commonly utilized expression system for producing recombinant pXO2-22 protein . This bacterial expression system offers several advantages for protein production:

  • Well-established protocols for transformation and protein expression

  • High protein yields suitable for structural and functional studies

  • Compatibility with N-terminal His-tagging for efficient purification

What are the optimal storage conditions for maintaining pXO2-22 protein stability?

The recombinant pXO2-22 protein is typically supplied as a lyophilized powder, which offers enhanced stability during shipping and long-term storage . For optimal stability, researchers should adhere to the following storage recommendations:

  • Store the lyophilized protein at -20°C to -80°C upon receipt

  • After reconstitution, store working aliquots at 4°C for up to one week

  • For long-term storage of reconstituted protein, add glycerol to a final concentration of 5-50% (with 50% being standard) and store in aliquots at -20°C to -80°C

  • Avoid repeated freeze-thaw cycles as this can significantly reduce protein activity and integrity

Maintaining proper storage conditions is critical for preserving protein structure and function, especially for uncharacterized proteins where stability parameters may not be fully established.

How does pXO2-22 interact with the pagR regulatory network in B. anthracis virulence?

The pXO2-22 protein exists within a complex virulence regulatory network in B. anthracis that involves both pXO1 and pXO2 plasmids. The pagR gene on pXO2 (pagR-XO2) has been shown to positively regulate virulence gene expression and toxin production . While the specific interaction between pXO2-22 and pagR has not been fully characterized, research suggests potential functional relationships:

The pagR-XO2 gene influences the expression of critical virulence factors encoded on pXO1, including protective antigen (PA) through the pagA gene . Transcriptional studies have demonstrated that mutations in the pagR-XO2 promoter region affect toxin production, with RT-PCR assays showing that pagR-XO2 can regulate pagA and lef gene expression by negatively regulating pagR-XO1 transcription .

This regulatory connection between plasmids reveals a sophisticated coordination between pXO2-encoded proteins (potentially including pXO2-22) and toxin expression. To investigate these interactions, researchers should design experiments that:

  • Assess protein-protein interactions between pXO2-22 and pagR components using co-immunoprecipitation or yeast two-hybrid assays

  • Analyze transcriptional changes in virulence genes following pXO2-22 knockout or overexpression

  • Examine functional domains within pXO2-22 that might contribute to regulatory activities

What experimental approaches are most effective for studying the function of pXO2-22 in anthrax pathogenesis?

Investigating the function of pXO2-22 in anthrax pathogenesis requires a multi-faceted experimental approach:

  • Gene Knockout and Complementation Studies:

    • Generate a pXO2-22 deletion mutant using homologous recombination techniques

    • Confirm deletion by PCR and sequence analysis

    • Create a complementation strain to verify phenotypic changes are due to the specific gene deletion

    • Assess virulence changes in both in vitro and in vivo models

  • Transcriptomic Analysis:

    • Perform RNA-seq comparing wild-type and pXO2-22 mutant strains

    • Use RT-PCR to validate expression changes in key virulence genes

    • Analyze data to identify regulatory networks affected by pXO2-22

  • Structural Characterization:

    • Express and purify recombinant pXO2-22 using His-tag affinity purification

    • Perform structural analysis through X-ray crystallography or NMR

    • Identify functional domains through bioinformatic analysis

  • Protein Interaction Studies:

    • Conduct pull-down assays to identify protein binding partners

    • Use bacterial two-hybrid systems to confirm direct interactions

    • Map interaction domains through truncation or point mutation studies

The experimental design should incorporate both molecular and cellular approaches to comprehensively characterize this uncharacterized protein's role in anthrax pathogenesis.

How can site-directed mutagenesis be optimized for studying functional domains in pXO2-22?

Site-directed mutagenesis represents a powerful approach for dissecting the functional domains of pXO2-22. Based on established methodologies for related proteins, the following optimization strategies are recommended:

Table 1: Site-Directed Mutagenesis Optimization Parameters for pXO2-22

ParameterRecommended ConditionRationale
Mutagenesis MethodOverlap Extension PCR (SOE PCR)Allows precise introduction of point mutations with high fidelity
DNA PolymerasePfu high-fidelity enzymeReduces error rate during amplification
Primer Design25-35 nucleotides with mutation in middleEnsures sufficient complementarity while introducing desired mutation
Template Concentration10-50 ng plasmid DNABalances amplification efficiency with specificity
Post-PCR ProcessingDpnI digestionRemoves methylated template DNA, enriching for mutant constructs

When designing a mutagenesis experiment:

  • First construct a recombinant plasmid containing the wild-type pXO2-22 gene in an appropriate expression vector

  • Design complementary primers containing the desired mutation (consider conserved domains or predicted functional regions)

  • Perform SOE PCR using the wild-type construct as template

  • Transform the PCR product into competent cells following DpnI digestion

  • Screen transformants by restriction enzyme analysis and confirm mutations by sequencing

This approach has been successfully applied to study functional domains in related proteins like BCKD, where researchers utilized SOE PCR to create the point mutation plasmid pGEX-BCKD-E4A .

What are the current hypotheses regarding the membrane localization of pXO2-22 and experimental approaches to test them?

Analysis of the pXO2-22 amino acid sequence reveals hydrophobic regions consistent with potential transmembrane domains . Current hypotheses regarding membrane localization include:

  • pXO2-22 may function as an integral membrane protein involved in capsule transport or assembly

  • The protein could serve as a membrane-associated sensor for environmental signals

  • pXO2-22 might facilitate protein-protein interactions at the membrane interface between regulatory components

To experimentally test these hypotheses, researchers should consider:

  • Membrane Fractionation Studies:

    • Separate bacterial cellular fractions (cytoplasmic, membrane, and extracellular)

    • Perform Western blot analysis to determine pXO2-22 localization

    • Compare localization patterns between virulent and attenuated strains

  • Fluorescent Tagging and Microscopy:

    • Generate GFP-tagged pXO2-22 constructs

    • Visualize protein localization using confocal microscopy

    • Perform co-localization studies with known membrane markers

  • Topology Mapping:

    • Use membrane-impermeable labeling reagents to identify exposed regions

    • Perform protease accessibility assays to determine protein orientation

    • Create fusion proteins with reporter enzymes to map transmembrane topology

These approaches would provide valuable insights into the spatial organization and potential membrane-associated functions of pXO2-22 in B. anthracis, similar to methodologies used for studying protein translocation across membranes .

What purification strategies yield the highest purity and activity for recombinant pXO2-22?

Obtaining high-purity, active pXO2-22 protein is crucial for downstream functional and structural studies. The following purification strategy is recommended:

Table 2: Optimized Purification Protocol for His-tagged pXO2-22

Purification StepMethodParametersExpected Outcome
Initial CaptureNi-NTA Affinity Chromatography20 mM imidazole wash, 250 mM imidazole elution>80% purity, removal of bulk contaminants
Secondary PurificationSize Exclusion ChromatographySuperdex 75/200 column, pH 7.4 buffer>90% purity, separation of aggregates and degradation products
Optional PolishingIon Exchange ChromatographyBased on pI of pXO2-22>95% purity for structural studies
Quality ControlSDS-PAGE and Western BlotAnti-His antibody detectionConfirmation of target protein identity and purity

Critical considerations during purification:

  • Include protease inhibitors in all buffers to prevent degradation

  • Optimize buffer conditions (pH, salt concentration) to maintain protein stability

  • Consider adding stabilizing agents (glycerol, reducing agents) if protein shows instability

  • Perform activity assays after each purification step to ensure functionality is maintained

  • For membrane-associated proteins like pXO2-22, inclusion of mild detergents may be necessary to maintain solubility

Final purified protein should be stored with 6% trehalose in Tris/PBS-based buffer at pH 8.0 for optimal stability, as indicated in the protein specifications .

How can researchers design functional assays to characterize the biochemical activities of pXO2-22?

Despite being uncharacterized, several functional assay approaches can be employed to elucidate pXO2-22's biochemical activities based on its context within the pXO2 plasmid and potential roles in virulence:

  • DNA-Binding Assays:

    • Perform electrophoretic mobility shift assays (EMSA) to test potential DNA-binding activity

    • Use chromatin immunoprecipitation (ChIP) to identify genomic binding sites

    • Test binding affinity for promoter regions of known virulence genes

  • Protein-Protein Interaction Assays:

    • Conduct pull-down assays with potential interacting partners (e.g., pagR)

    • Perform surface plasmon resonance (SPR) to measure binding kinetics

    • Use yeast two-hybrid screening to identify novel binding partners

  • Enzymatic Activity Assays:

    • Test for potential enzymatic activities (kinase, phosphatase, protease) using appropriate substrates

    • Monitor changes in substrate using spectrometric or fluorometric detection

    • Perform comparative activity assays with wild-type and mutant variants

  • Transcriptional Reporter Assays:

    • Construct reporter systems (luciferase, GFP) under control of virulence gene promoters

    • Measure reporter activity in presence/absence of pXO2-22

    • Test the effect of pXO2-22 on pagR-regulated gene expression

These assays should be selected based on bioinformatic predictions of protein function and structural features, with priority given to testing the hypothesis that pXO2-22 may participate in the pagR regulatory network that controls toxin expression in B. anthracis.

What approaches are recommended for investigating potential interactions between pXO2-22 and the pagR regulatory system?

Given the established role of pagR in anthrax pathogenesis and virulence regulation, investigating potential interactions between pXO2-22 and the pagR regulatory system is critical. Recommended approaches include:

  • Co-Expression and Co-Immunoprecipitation:

    • Co-express tagged versions of pXO2-22 and pagR proteins

    • Perform co-immunoprecipitation followed by Western blot analysis

    • Confirm interactions through reciprocal pull-down experiments

  • Transcriptional Analysis:

    • Generate pXO2-22 knockout and overexpression strains

    • Measure pagR-XO1 and pagR-XO2 expression levels using RT-PCR

    • Analyze expression patterns of downstream targets (pagA, lef) regulated by pagR

    • Compare results to established pagR regulatory patterns shown in previous studies

  • Bacterial Two-Hybrid System:

    • Create fusion constructs of pXO2-22 and pagR components with split reporter domains

    • Test for protein-protein interactions in bacterial host

    • Map interaction domains through truncation constructs

  • Competitive Binding Assays:

    • Purify recombinant pXO2-22 and pagR proteins

    • Test for competitive binding to pagA promoter regions

    • Analyze whether pXO2-22 modulates pagR binding activity

These experimental approaches would help elucidate whether pXO2-22 participates in the complex regulatory network involving pagR genes on both pXO1 and pXO2 plasmids, which has been shown to influence toxin expression through a mechanism of mutual coordination and restraint .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.