Recombinant Uncharacterized protein pXO2-65/BXB0087/GBAA_pXO2_0087 (pXO2-65, BXB0087, GBAA_pXO2_0087)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing the order, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is dependent on several factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
pXO2-65; BXB0087; GBAA_pXO2_0087; Uncharacterized protein pXO2-65/BXB0087/GBAA_pXO2_0087
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Bacillus anthracis
Target Names
pXO2-65
Target Protein Sequence
MKIWKNILNIILALAVPIGLLFISMMIGEGVLDLFLDILNINYDDLSYLEEKAFAMFIPL LIIALTLLVTFLHHRSLRPLRLSTGFLSKETYKNYGIGIGIVFIFLSLIQS
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the pXO2-65/BXB0087/GBAA_pXO2_0087 protein and where is it located in the bacterial genome?

The pXO2-65/BXB0087/GBAA_pXO2_0087 protein is encoded on the large 96.2 kb plasmid pXO2 of Bacillus anthracis, the causative agent of anthrax . This plasmid is one of two virulence plasmids essential for full pathogenicity of B. anthracis, with pXO2 specifically responsible for capsule formation. The protein is designated within a region of pXO2 that contains genes associated with the capsule biosynthesis machinery, suggesting a possible role in virulence. The naming convention follows the standard genomic annotation where "GBAA" refers to the B. anthracis Ames Ancestor strain, while "BXB" refers to the B. anthracis Ames strain annotation system . The protein's gene is located within the 25.3 kb region spanning nucleotides 48242–73500 of the pXO2 plasmid, which has distinct sequence characteristics compared to the rest of the plasmid.

Why is pXO2-65 classified as an "uncharacterized protein"?

pXO2-65 is classified as "uncharacterized" because its precise biological function, biochemical properties, and three-dimensional structure have not been fully elucidated through experimental validation. The complete sequencing and annotation of the pXO2 plasmid identified 85 open reading frames (ORFs), but little is known about the identity and function of many of these ORFs beyond those directly associated with capsule formation (dep, capACB, acpA) . The protein may have been identified through genomic sequencing and computational prediction methods, but without substantial functional characterization through biochemical assays, mutational studies, or structural determination. The annotation is primarily based on sequence analysis rather than experimental verification of function, which is common for many proteins identified through genome sequencing projects.

How can I express recombinant pXO2-65 protein for in vitro studies?

To express recombinant pXO2-65 protein, researchers should consider a methodological approach similar to that used for the RepS protein of pXO2. The gene should first be PCR-amplified from purified pXO2 plasmid DNA using high-fidelity polymerase and specific primers designed based on the published sequence. The amplified gene can be cloned into an expression vector with an appropriate fusion tag to facilitate purification. For example, a maltose-binding protein (MBP) fusion strategy has been successfully employed for the RepS protein from pXO2 . Expression in E. coli BL21(DE3) or similar strains optimized for protein expression, followed by induction with IPTG at lower temperatures (16-20°C) for 16-20 hours often yields better results for potentially toxic or poorly folding proteins. Purification can be performed using affinity chromatography based on the chosen tag, followed by size exclusion chromatography to obtain pure protein. Western blotting with antibodies against the tag or the protein itself can confirm successful expression. For proteins that are difficult to express in E. coli, alternative expression systems such as B. subtilis could be considered, given that the pXO2 replicon has been shown to function in this species .

What are the predicted structural features and potential functions of pXO2-65 based on bioinformatic analyses?

Advanced bioinformatic analyses can provide valuable insights into the potential structure and function of pXO2-65. Researchers should employ a multi-tiered approach beginning with sequence-based predictions. Homology detection tools like HHpred, PHYRE2, and I-TASSER can identify remote homologs with known structures even when sequence identity is low (<20%). For pXO2-65, particular attention should be paid to structural similarities with other virulence factors or proteins involved in capsule formation, given its location in the capsule-associated region of pXO2. Protein domain analysis using InterPro, SMART, or CDD might reveal conserved functional domains. Secondary structure prediction (using PSIPRED or JPred) combined with disorder prediction (DISOPRED, IUPred) would help identify structured regions suitable for crystallization. Researchers should also conduct comparative genomics analyses examining the conservation of pXO2-65 across different Bacillus species. The pXO2 plasmid has genes with sequence conservation in other related Bacillus species, but the 25.3 kb capsule-associated region (where pXO2-65 is located) appears unique to B. anthracis . This distinctive conservation pattern suggests a potential specialized role in pathogenesis.

How can I determine if pXO2-65 interacts with other proteins in the pXO2 plasmid or chromosomal proteins?

To investigate protein-protein interactions involving pXO2-65, researchers should implement a comprehensive approach combining in vitro and in vivo methodologies. For in vitro studies, pull-down assays using purified recombinant pXO2-65 as bait (tagged with MBP, GST, or His) can be performed with B. anthracis cell lysates, followed by mass spectrometry identification of binding partners. Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can then quantify binding affinities with identified partners. For in vivo approaches, bacterial two-hybrid systems may be preferable to yeast two-hybrid due to the bacterial origin of pXO2-65. Alternatively, in vivo crosslinking followed by co-immunoprecipitation can capture transient or context-dependent interactions. Researchers should pay particular attention to potential interactions with the characterized capsule biosynthesis proteins (CapA, CapB, CapC, Dep, AcpA), given pXO2-65's genomic proximity to these genes . Verification of identified interactions should include reverse co-immunoprecipitation experiments and functional assays to determine the biological significance of these interactions. Bacterial adenylate cyclase-based two-hybrid (BACTH) system could be especially valuable for screening interactions with membrane-associated proteins if pXO2-65 has predicted transmembrane domains.

What approaches can I use to investigate the role of pXO2-65 in B. anthracis virulence?

Investigating the role of pXO2-65 in virulence requires a multi-faceted approach combining genetic manipulation, cellular assays, and infection models. Begin with targeted gene deletion using allelic exchange techniques optimized for B. anthracis, such as the pXO2 minireplicon system that has been established for genetic manipulations . Create complementation strains expressing wild-type pXO2-65 to confirm phenotypes. Phenotypic characterization should include assessment of growth kinetics in various media, capsule production (using India ink staining and capsule immunodetection), and resistance to host immune defenses (particularly phagocytosis and complement-mediated killing). For cellular assays, compare the ability of wild-type and mutant strains to adhere to, invade, and survive within relevant host cells (macrophages, lung epithelial cells). In animal models, adjust inoculation routes based on the natural infection pathway (subcutaneous, inhalational, or gastrointestinal). Use both mouse models for preliminary studies and more relevant animal models (guinea pigs, rabbits) that better recapitulate human anthrax. For biosafety reasons, consider using attenuated strains lacking the pXO1 plasmid as background for initial studies, adding the pXO1 component only for critical virulence assessments in appropriate containment facilities.

How can I develop specific antibodies against pXO2-65 for research purposes?

Developing specific antibodies against pXO2-65 requires careful epitope selection and validation strategies. Begin by analyzing the protein sequence using epitope prediction algorithms (BepiPred, ABCpred) to identify surface-exposed, immunogenic regions. For polyclonal antibodies, express and purify the full-length recombinant protein as described in section 2.3, using either MBP or His tags that can be removed before immunization. Immunize rabbits or goats with 200-500 μg of purified protein using a standard 8-12 week protocol with complete Freund's adjuvant for initial immunization and incomplete Freund's for boosters. For monoclonal antibodies, consider using synthetic peptides corresponding to unique epitopes predicted to be surface-exposed. After hybridoma generation, implement a rigorous validation pipeline including ELISA against recombinant protein, Western blotting, and immunoprecipitation. Crucially, validate specificity using extracts from B. anthracis strains with and without the pXO2-65 gene to confirm absence of cross-reactivity with other bacterial proteins. For advanced applications like immunofluorescence microscopy, test antibodies on fixed B. anthracis cells expressing and lacking pXO2-65. Consider epitope tagging of the native protein (if genetic manipulation is possible) as a complementary approach for detection when antibody development proves challenging.

What methods can I use to determine the subcellular localization of pXO2-65 in B. anthracis?

Determining the subcellular localization of pXO2-65 requires a combination of computational prediction, biochemical fractionation, and microscopy techniques. Begin with in silico analysis using tools like PSORTb, CELLO, and SignalP to predict potential localization signals (cytoplasmic, membrane-associated, secreted). For biochemical approaches, perform careful subcellular fractionation of B. anthracis cells into cytoplasmic, membrane, cell wall, and extracellular fractions, followed by Western blot analysis using validated antibodies against pXO2-65. For microscopy visualization, create a fusion protein with a fluorescent tag (GFP or mCherry) expressed from its native promoter and introduced into B. anthracis, ideally replacing the wild-type gene through homologous recombination. Confocal microscopy can then visualize the protein's location relative to membrane stains. Immunogold electron microscopy using specific antibodies against pXO2-65 provides nanometer-scale resolution of protein localization. If the protein is secreted or associated with the capsule, analyze the culture supernatant and capsule extracts. Given that pXO2-65 is located in the genomic region containing capsule-associated genes, pay particular attention to potential associations with the bacterial capsule or cell envelope structures .

How can I investigate the potential involvement of pXO2-65 in capsule formation or regulation?

To investigate pXO2-65's potential role in capsule formation or regulation, implement a systematic approach combining genetic, biochemical, and microscopic methods. Generate a clean deletion mutant of pXO2-65 using allelic exchange, then thoroughly characterize capsule production both quantitatively and qualitatively. Quantify capsule production using India ink negative staining, immunofluorescence with anti-capsule antibodies, and ELISA-based D-glutamic acid measurement methods. Examine capsule architecture using electron microscopy, particularly transmission electron microscopy with ruthenium red staining specific for polysaccharide capsules. Analyze the expression of known capsule biosynthesis genes (capA, capB, capC, dep) in the wild-type versus ΔpXO2-65 strains using RT-qPCR under various growth conditions, including host-mimicking environments (37°C, 5% CO2, serum-containing media). Perform complementation studies with the wild-type gene to confirm phenotypes. For a biochemical approach, investigate whether purified recombinant pXO2-65 interacts directly with capsular material or capsule biosynthesis enzymes using in vitro binding assays. Consider a proteomic comparison of capsule composition between wild-type and mutant strains to identify any structural differences. Since the capsule is a critical virulence factor for B. anthracis, correlate any observed changes in capsule formation with impacts on interactions with host immune cells, particularly resistance to phagocytosis.

How can I analyze the transcriptional regulation of the pXO2-65 gene?

Analyzing the transcriptional regulation of pXO2-65 requires a comprehensive approach examining both cis- and trans-regulatory elements. Begin by identifying the promoter region through 5' RACE (Rapid Amplification of cDNA Ends) to precisely map the transcription start site. Use bioinformatic tools to identify potential regulatory elements in the promoter region, including -10 and -35 boxes, transcription factor binding sites, and possible regulatory RNA structures. Construct transcriptional reporter fusions using the pXO2-65 promoter region linked to a reporter gene (such as lacZ or a fluorescent protein) and measure activity under various conditions relevant to B. anthracis life cycle: different growth phases, oxygen levels, temperatures, pH values, and host-mimicking conditions. To identify trans-acting factors, perform DNA-protein interaction studies such as electrophoretic mobility shift assays (EMSAs) using the promoter region as bait and B. anthracis protein extracts. Promising interacting proteins can be identified by mass spectrometry and validated through chromatin immunoprecipitation (ChIP). Of particular interest would be examining whether known regulatory proteins controlling virulence in B. anthracis, such as AtxA (which has a homolog on pXO2 - ORF 61), influence pXO2-65 expression . Create deletion mutants of candidate regulators and assess impacts on pXO2-65 transcription using RT-qPCR.

What techniques can I use to determine if pXO2-65 is co-transcribed with neighboring genes?

Determining whether pXO2-65 is co-transcribed with neighboring genes requires several complementary approaches to characterize operon structure. Begin with bioinformatic analysis of the pXO2 sequence surrounding pXO2-65, examining intergenic distances and orientation of adjacent genes. Perform reverse transcription PCR (RT-PCR) spanning the junctions between pXO2-65 and adjacent genes; amplification products indicate co-transcription within a polycistronic mRNA. For more comprehensive analysis, conduct 5' and 3' RACE to identify all transcription start sites and termination points in the region. Northern blot analysis using probes specific to pXO2-65 can reveal the size of the complete transcript, helping determine whether it's monocistronic or polycistronic. RNA-Seq with specific attention to transcript coverage and junction reads provides genome-wide context and can identify operon structures across the entire plasmid. To examine coordination of expression, perform RT-qPCR on multiple genes in the putative operon under various conditions to determine if they show similar expression patterns. Given the genomic location of pXO2-65 in the capsule-associated region of pXO2, special attention should be paid to potential co-transcription with other genes involved in capsule biosynthesis or regulation . Understanding the operon structure will provide valuable insights into the functional relationships between pXO2-65 and neighboring genes.

What crystallization conditions should I consider for structural determination of pXO2-65?

For successful crystallization of pXO2-65, researchers should implement a systematic screening approach optimized for bacterial proteins. Begin with producing highly pure (>95% by SDS-PAGE), homogeneous protein at concentrations of 5-15 mg/mL. Use size exclusion chromatography as a final purification step to ensure monodispersity. Perform thermal shift assays (Thermofluor) to identify stabilizing buffer conditions and additives before crystallization attempts. Initial screening should employ commercial sparse matrix screens (Hampton Research, Molecular Dimensions) at different temperatures (4°C, 16°C, and 20°C) using both vapor diffusion and microbatch methods. If the full-length protein resists crystallization, consider a domain-based approach based on bioinformatic predictions of structured domains. Limited proteolysis experiments can identify stable fragments suitable for crystallization. For proteins like pXO2-65 that come from the pXO2 plasmid, which contains many DNA-binding proteins and replication factors, include screens with various oligonucleotides if sequence analysis suggests DNA-binding motifs . Surface entropy reduction mutations (replacing surface clusters of high-entropy residues like Lys/Glu with alanines) can promote crystal contacts. If crystallization proves challenging, consider alternative structural approaches such as cryo-electron microscopy for larger assemblies or NMR for smaller domains. Successful crystallization of similar pXO2-encoded proteins could provide useful starting conditions.

How can I determine if pXO2-65 binds to DNA or RNA and identify its target sequences?

To investigate potential nucleic acid binding properties of pXO2-65, employ a tiered approach beginning with in vitro binding assays. Electrophoretic mobility shift assays (EMSAs) with purified recombinant pXO2-65 can screen for general binding to different nucleic acid types (ssDNA, dsDNA, RNA) similar to the approach used for the RepS protein of pXO2 . If binding is detected, characterize binding preferences through competition experiments with specific vs. non-specific sequences. For unbiased identification of binding sequences, employ SELEX (Systematic Evolution of Ligands by Exponential Enrichment) to discover high-affinity binding motifs from random sequence pools. Results can be confirmed using quantitative binding assays like fluorescence polarization or isothermal titration calorimetry to determine binding constants. For in vivo target identification, chromatin immunoprecipitation followed by sequencing (ChIP-seq) or RNA immunoprecipitation (RIP-seq) can map genome-wide binding sites. DNase I footprinting or hydrogen-deuterium exchange mass spectrometry can precisely map protein-nucleic acid interaction interfaces at single-nucleotide resolution. If pXO2-65 shows similarity to the RepS protein of pXO2, which specifically binds to the origin of replication , particular attention should be paid to potential roles in plasmid replication or gene regulation through sequence-specific DNA binding.

How has pXO2-65 evolved within the B. anthracis lineage?

To investigate the evolution of pXO2-65 within the B. anthracis lineage, researchers should perform comprehensive sequence analysis across diverse B. anthracis isolates representing different geographical origins and outbreaks. Sequence multiple pXO2-65 alleles and calculate nucleotide diversity (π) and Ka/Ks ratios to identify signatures of purifying, neutral, or positive selection. Compare these metrics with those of other pXO2 genes to determine if pXO2-65 shows distinctive evolutionary patterns. Use Bayesian or maximum likelihood methods to reconstruct the evolutionary history of pXO2-65 and estimate divergence times. Analyze the broader evolutionary context by examining the pXO2 plasmid's evolution – its acquisition appears to be a key event in B. anthracis speciation from the B. cereus group. The pXO2 plasmid shows evidence of horizontal transfer among bacteria in the B. cereus/thuringiensis group , but the capsule region where pXO2-65 is located appears unique to B. anthracis . This suggests the capsule region may have been acquired as a discrete genetic unit or evolved significantly after acquisition. Examine the GC content and codon usage of pXO2-65 compared to the rest of the plasmid and chromosome to identify potential foreign origin signatures. Pay particular attention to the relationship between pXO2-65 and homologous sequences in pAW63 from B. thuringiensis, which shares replication machinery with pXO2 .

What are the most promising approaches for characterizing the function of uncharacterized proteins like pXO2-65?

Characterizing uncharacterized proteins like pXO2-65 requires an integrated systems biology approach combining cutting-edge technologies. High-throughput phenotypic screens using transposon mutagenesis coupled with next-generation sequencing (Tn-Seq) can identify conditions where pXO2-65 becomes essential or beneficial for bacterial fitness. CRISPR interference (CRISPRi) offers finer temporal control for depleting the protein and observing immediate phenotypic consequences. For protein interaction networks, proximity labeling methods such as BioID or APEX can identify proteins that physically associate with pXO2-65 in vivo, while global protein correlation profiling across fractionated cell extracts can identify functional associations. Metabolomic profiling comparing wild-type and knockout strains can reveal altered metabolic pathways. For structural insights, AlphaFold2 and similar AI-based structure prediction tools provide increasingly accurate models that can guide hypothesis generation. Single-cell techniques examining transcriptional responses in individual bacteria during infection can reveal cell-state-specific functions. Considering pXO2-65's location on the virulence plasmid pXO2, focus on infection-relevant conditions such as macrophage interaction, blood exposure, and animal infection models. The functional characterization should leverage insights from both the genomic context – its location in the capsule-associated region of pXO2 – and any structural predictions to design targeted experiments rather than purely exploratory approaches.

How might pXO2-65 be exploited for biotechnology applications or therapeutic development?

Exploiting pXO2-65 for biotechnology applications or therapeutic development presents several promising avenues based on its location on the virulence plasmid. As a potential virulence-associated protein, pXO2-65 could serve as a novel target for anti-virulence therapeutics that disarm B. anthracis without inducing selective pressure through growth inhibition. High-throughput screening of chemical libraries against purified pXO2-65 could identify small molecule inhibitors disrupting its function. For vaccine development, if pXO2-65 is surface-exposed or secreted, it might represent a novel antigen candidate for inclusion in next-generation anthrax vaccines, particularly if it proves to be highly conserved across B. anthracis strains. For diagnostic applications, pXO2-65-specific antibodies or aptamers could enhance detection specificity, as the 25.3 kb region containing pXO2-65 appears unique to B. anthracis compared to related Bacillus species . The protein could also serve as a building block for synthetic biology applications, particularly if it possesses unique binding or catalytic properties. If pXO2-65 has DNA-binding capabilities similar to other proteins encoded on pXO2 like RepS , it might be engineered as a novel DNA-targeting tool for biotechnology applications. Any biotechnological exploitation requires thorough characterization of protein function, structure, and interaction partners, making the research questions outlined in previous sections essential prerequisites.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.